BLASTX nr result
ID: Atractylodes22_contig00012527
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00012527 (245 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAM23004.1|AF502433_1 orcinol O-methyltransferase [Rosa hybri... 59 5e-07 gb|AAM23005.1|AF502434_1 orcinol O-methyltransferase [Rosa hybri... 56 3e-06 gb|AEC13057.1| orcinol O-methyltransferase-like protein [Rosa ch... 56 3e-06 ref|XP_002525159.1| o-methyltransferase, putative [Ricinus commu... 55 4e-06 >gb|AAM23004.1|AF502433_1 orcinol O-methyltransferase [Rosa hybrid cultivar] gi|27527922|emb|CAD29458.1| orcinol O-methyltransferase [Rosa chinensis] gi|53748110|emb|CAH05077.1| orcinol O-methyltransferase 1 [Rosa chinensis] Length = 367 Score = 58.5 bits (140), Expect = 5e-07 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = -3 Query: 243 KDWAKLLLDAGFSDHRITPISGLRSLIEVYP 151 K+WAKL DAGFSD++ITPISGLRSLIEVYP Sbjct: 337 KEWAKLFTDAGFSDYKITPISGLRSLIEVYP 367 >gb|AAM23005.1|AF502434_1 orcinol O-methyltransferase [Rosa hybrid cultivar] gi|27527924|emb|CAD29459.1| orcinol O-methyltransferase [Rosa chinensis] gi|53748112|emb|CAH05078.1| orcinol O-methyltransferase 2 [Rosa chinensis] Length = 366 Score = 56.2 bits (134), Expect = 3e-06 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = -3 Query: 243 KDWAKLLLDAGFSDHRITPISGLRSLIEVYP 151 K+WAKL DAGFSD++ITPI GLRSLIEVYP Sbjct: 336 KEWAKLFTDAGFSDYKITPILGLRSLIEVYP 366 >gb|AEC13057.1| orcinol O-methyltransferase-like protein [Rosa chinensis] Length = 367 Score = 56.2 bits (134), Expect = 3e-06 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = -3 Query: 243 KDWAKLLLDAGFSDHRITPISGLRSLIEVYP 151 K+WAKL DAGFSD++ITPI GLRSLIEVYP Sbjct: 337 KEWAKLFTDAGFSDYKITPILGLRSLIEVYP 367 >ref|XP_002525159.1| o-methyltransferase, putative [Ricinus communis] gi|223535618|gb|EEF37286.1| o-methyltransferase, putative [Ricinus communis] Length = 356 Score = 55.5 bits (132), Expect = 4e-06 Identities = 24/31 (77%), Positives = 28/31 (90%) Frame = -3 Query: 243 KDWAKLLLDAGFSDHRITPISGLRSLIEVYP 151 K+W KL LDAGFSD++ITPI GLRS+IEVYP Sbjct: 326 KEWGKLFLDAGFSDYKITPILGLRSVIEVYP 356