BLASTX nr result
ID: Atractylodes22_contig00012414
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00012414 (399 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002531928.1| leucine-rich repeat-containing protein, puta... 76 3e-12 ref|XP_003607698.1| Tir-nbs-lrr resistance protein [Medicago tru... 74 1e-11 ref|XP_003607596.1| Tir-nbs-lrr resistance protein [Medicago tru... 74 1e-11 gb|ABF81419.1| TIR-NBS-LRR type disease resistance protein [Popu... 74 1e-11 ref|XP_003607691.1| Tir-nbs-lrr resistance protein [Medicago tru... 74 2e-11 >ref|XP_002531928.1| leucine-rich repeat-containing protein, putative [Ricinus communis] gi|223528407|gb|EEF30442.1| leucine-rich repeat-containing protein, putative [Ricinus communis] Length = 943 Score = 76.3 bits (186), Expect = 3e-12 Identities = 39/85 (45%), Positives = 55/85 (64%), Gaps = 2/85 (2%) Frame = +1 Query: 7 QYFPNYLRHLSWLGYPFSYLPKTFQANNLVTLGLRDSEIVQLWEGPERKVLNKLRFLRLD 186 +Y N LR+L W GYPF LP TFQ+N L+ L + S++ Q+WEG K NKL+ ++L Sbjct: 395 EYLSNELRYLKWYGYPFRNLPCTFQSNELLELNMSYSQVEQIWEG--TKQFNKLKIMKLS 452 Query: 187 NSK--VRTFNLGMTPNLEELSLSGC 255 +SK V+T + P+LE+L L GC Sbjct: 453 HSKNLVKTPDFRGVPSLEKLVLEGC 477 >ref|XP_003607698.1| Tir-nbs-lrr resistance protein [Medicago truncatula] gi|355508753|gb|AES89895.1| Tir-nbs-lrr resistance protein [Medicago truncatula] Length = 1165 Score = 74.3 bits (181), Expect = 1e-11 Identities = 42/81 (51%), Positives = 49/81 (60%), Gaps = 2/81 (2%) Frame = +1 Query: 19 NYLRHLSWLGYPFSYLPKTFQANNLVTLGLRDSEIVQLWEGPERKVLNKLRFLRLDNSK- 195 N LR++ W YPF YLP +FQ LV L L DS I QLWEG K L LR L L NSK Sbjct: 587 NELRYVEWREYPFMYLPSSFQPYQLVELILEDSSIKQLWEG--TKYLPNLRTLELRNSKS 644 Query: 196 -VRTFNLGMTPNLEELSLSGC 255 ++ + G PNLE L+L GC Sbjct: 645 LIKVPDFGEIPNLERLNLKGC 665 >ref|XP_003607596.1| Tir-nbs-lrr resistance protein [Medicago truncatula] gi|355508651|gb|AES89793.1| Tir-nbs-lrr resistance protein [Medicago truncatula] Length = 1039 Score = 73.9 bits (180), Expect = 1e-11 Identities = 40/84 (47%), Positives = 54/84 (64%), Gaps = 2/84 (2%) Frame = +1 Query: 10 YFPNYLRHLSWLGYPFSYLPKTFQANNLVTLGLRDSEIVQLWEGPERKVLNKLRFLRLDN 189 Y N LR++ W YPF+YLPK+FQ N LV L L S I QLW+G +K L LR + L + Sbjct: 581 YLSNELRYVEWNRYPFTYLPKSFQPNQLVELHLSYSSIKQLWKG--KKYLPNLRIMDLMH 638 Query: 190 SK--VRTFNLGMTPNLEELSLSGC 255 S+ ++ + G PNLE L+L+GC Sbjct: 639 SRNLIKLPDFGEVPNLEMLNLAGC 662 >gb|ABF81419.1| TIR-NBS-LRR type disease resistance protein [Populus trichocarpa] Length = 1121 Score = 73.9 bits (180), Expect = 1e-11 Identities = 40/85 (47%), Positives = 52/85 (61%), Gaps = 2/85 (2%) Frame = +1 Query: 7 QYFPNYLRHLSWLGYPFSYLPKTFQANNLVTLGLRDSEIVQLWEGPERKVLNKLRFLRLD 186 +Y N LR+L W YPF LP TFQ + LV L +R S I QLWEGP L LR + L Sbjct: 609 KYLSNELRYLEWCRYPFKSLPSTFQPDKLVELHMRHSSIKQLWEGP----LKLLRAIDLR 664 Query: 187 NSK--VRTFNLGMTPNLEELSLSGC 255 +S+ ++T + PNLE+L+L GC Sbjct: 665 HSRNLIKTPDFRQVPNLEKLNLEGC 689 >ref|XP_003607691.1| Tir-nbs-lrr resistance protein [Medicago truncatula] gi|355508746|gb|AES89888.1| Tir-nbs-lrr resistance protein [Medicago truncatula] Length = 1050 Score = 73.6 bits (179), Expect = 2e-11 Identities = 40/81 (49%), Positives = 50/81 (61%), Gaps = 2/81 (2%) Frame = +1 Query: 19 NYLRHLSWLGYPFSYLPKTFQANNLVTLGLRDSEIVQLWEGPERKVLNKLRFLRLDNSK- 195 N LR+++W GYPF YLP F+ N LV L + DS I QLWEG +K L LR L L S Sbjct: 575 NQLRYVAWNGYPFMYLPSNFRPNQLVELIMVDSSIKQLWEG--KKNLPNLRTLDLSYSTN 632 Query: 196 -VRTFNLGMTPNLEELSLSGC 255 ++ + G PNLE L+L GC Sbjct: 633 LIKMLDFGEVPNLERLNLEGC 653