BLASTX nr result
ID: Atractylodes22_contig00012228
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00012228 (321 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003631483.1| PREDICTED: MORN repeat-containing protein 1-... 60 2e-07 ref|XP_002526486.1| 1-phosphatidylinositol-4-phosphate 5-kinase,... 55 8e-06 >ref|XP_003631483.1| PREDICTED: MORN repeat-containing protein 1-like [Vitis vinifera] Length = 432 Score = 60.1 bits (144), Expect = 2e-07 Identities = 36/86 (41%), Positives = 49/86 (56%), Gaps = 3/86 (3%) Frame = -2 Query: 251 PIYFFSSSINHHRSLYLYILFVIAFCGVLLSSFNL---NSPSIRPYIARNFPFLKIYRSD 81 P+YFF+ S RSL L L +AF ++ S NL PSIR ++AR+ P + Sbjct: 82 PLYFFTWS--PRRSLVLDFLSALAFSAAVVISLNLALPRLPSIRVFLARSLPIKLCSSAS 139 Query: 80 NVSKSRPPVVWSIGSKNRFEEHTTSG 3 + SK PV+WSIGSK + E+ T SG Sbjct: 140 SASKPSQPVLWSIGSKPKSEKRTNSG 165 >ref|XP_002526486.1| 1-phosphatidylinositol-4-phosphate 5-kinase, putative [Ricinus communis] gi|223534161|gb|EEF35877.1| 1-phosphatidylinositol-4-phosphate 5-kinase, putative [Ricinus communis] Length = 517 Score = 54.7 bits (130), Expect = 8e-06 Identities = 34/86 (39%), Positives = 48/86 (55%), Gaps = 3/86 (3%) Frame = -2 Query: 251 PIYFFSSSINHHRSLYLYILFVIAFCGVLLSSFNL---NSPSIRPYIARNFPFLKIYRSD 81 P ++F S H S L L AF LL S NL PSIR ++AR+FP +K+ + Sbjct: 166 PFFYFLVSHPSH-SFLLDFLSAFAFSAALLFSLNLALPRLPSIRLFLARSFP-IKLKSNS 223 Query: 80 NVSKSRPPVVWSIGSKNRFEEHTTSG 3 N+++ PV WSIGS+ + E+ SG Sbjct: 224 NITRPPFPVFWSIGSRTKSEKRANSG 249