BLASTX nr result
ID: Atractylodes22_contig00012148
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00012148 (249 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI39508.3| unnamed protein product [Vitis vinifera] 66 3e-09 emb|CBI36847.3| unnamed protein product [Vitis vinifera] 66 3e-09 ref|XP_002283865.1| PREDICTED: pre-mRNA-splicing factor SF2-like... 66 3e-09 ref|XP_002265998.1| PREDICTED: pre-mRNA-splicing factor SF2-like... 66 3e-09 ref|XP_002523079.1| arginine/serine-rich splicing factor, putati... 66 3e-09 >emb|CBI39508.3| unnamed protein product [Vitis vinifera] Length = 249 Score = 65.9 bits (159), Expect = 3e-09 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = +2 Query: 155 SRSSRTLYVGNLPGDIREREVEDLFYKYGPI 247 SRSSRT+YVGNLPGDIREREVEDLFYKYGPI Sbjct: 3 SRSSRTVYVGNLPGDIREREVEDLFYKYGPI 33 >emb|CBI36847.3| unnamed protein product [Vitis vinifera] Length = 264 Score = 65.9 bits (159), Expect = 3e-09 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = +2 Query: 155 SRSSRTLYVGNLPGDIREREVEDLFYKYGPI 247 SR+SRTLYVGNLPGDIREREVEDLFYKYGPI Sbjct: 3 SRASRTLYVGNLPGDIREREVEDLFYKYGPI 33 >ref|XP_002283865.1| PREDICTED: pre-mRNA-splicing factor SF2-like [Vitis vinifera] Length = 288 Score = 65.9 bits (159), Expect = 3e-09 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = +2 Query: 155 SRSSRTLYVGNLPGDIREREVEDLFYKYGPI 247 SRSSRT+YVGNLPGDIREREVEDLFYKYGPI Sbjct: 3 SRSSRTVYVGNLPGDIREREVEDLFYKYGPI 33 >ref|XP_002265998.1| PREDICTED: pre-mRNA-splicing factor SF2-like isoform 1 [Vitis vinifera] gi|359480272|ref|XP_003632425.1| PREDICTED: pre-mRNA-splicing factor SF2-like isoform 2 [Vitis vinifera] Length = 296 Score = 65.9 bits (159), Expect = 3e-09 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = +2 Query: 155 SRSSRTLYVGNLPGDIREREVEDLFYKYGPI 247 SR+SRTLYVGNLPGDIREREVEDLFYKYGPI Sbjct: 3 SRASRTLYVGNLPGDIREREVEDLFYKYGPI 33 >ref|XP_002523079.1| arginine/serine-rich splicing factor, putative [Ricinus communis] gi|223537641|gb|EEF39264.1| arginine/serine-rich splicing factor, putative [Ricinus communis] Length = 292 Score = 65.9 bits (159), Expect = 3e-09 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = +2 Query: 155 SRSSRTLYVGNLPGDIREREVEDLFYKYGPI 247 SR+SRTLYVGNLPGDIREREVEDLFYKYGPI Sbjct: 3 SRASRTLYVGNLPGDIREREVEDLFYKYGPI 33