BLASTX nr result
ID: Atractylodes22_contig00010909
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00010909 (960 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_200811.1| uncharacterized protein [Arabidopsis thaliana] ... 79 2e-12 ref|XP_002866363.1| hypothetical protein ARALYDRAFT_496141 [Arab... 76 1e-11 ref|XP_002531826.1| conserved hypothetical protein [Ricinus comm... 75 3e-11 gb|ABK28002.1| unknown [Arabidopsis thaliana] 73 1e-10 ref|NP_001117602.1| uncharacterized protein [Arabidopsis thalian... 73 1e-10 >ref|NP_200811.1| uncharacterized protein [Arabidopsis thaliana] gi|8777342|dbj|BAA96932.1| unnamed protein product [Arabidopsis thaliana] gi|332009885|gb|AED97268.1| uncharacterized protein [Arabidopsis thaliana] Length = 292 Score = 79.0 bits (193), Expect = 2e-12 Identities = 41/81 (50%), Positives = 54/81 (66%) Frame = -3 Query: 745 MKTVSGKVVSTKPVNLSKAANILSNFVTSDNGASQSVSAYLRRASTAFNELVYFXXXXXX 566 MKTV+G+VVS +P++LSKAA +LS F +SDNGASQ VSAYLRRAS AF EL F Sbjct: 1 MKTVTGRVVSAEPISLSKAAKLLSGFASSDNGASQDVSAYLRRASAAFTELKSFHREIKS 60 Query: 565 XXHRAKEEASSKSDINPRNSE 503 + + +KS ++S+ Sbjct: 61 KETKPSSDRETKSTETKQSSD 81 >ref|XP_002866363.1| hypothetical protein ARALYDRAFT_496141 [Arabidopsis lyrata subsp. lyrata] gi|297312198|gb|EFH42622.1| hypothetical protein ARALYDRAFT_496141 [Arabidopsis lyrata subsp. lyrata] Length = 268 Score = 76.3 bits (186), Expect = 1e-11 Identities = 37/54 (68%), Positives = 45/54 (83%) Frame = -3 Query: 745 MKTVSGKVVSTKPVNLSKAANILSNFVTSDNGASQSVSAYLRRASTAFNELVYF 584 MKTV+G+V+S +P++LSKAA +LS F +SDNGASQ VSAYLRRAS AF EL F Sbjct: 1 MKTVTGRVISAEPISLSKAATLLSGFASSDNGASQDVSAYLRRASAAFTELKSF 54 >ref|XP_002531826.1| conserved hypothetical protein [Ricinus communis] gi|223528522|gb|EEF30546.1| conserved hypothetical protein [Ricinus communis] Length = 224 Score = 74.7 bits (182), Expect = 3e-11 Identities = 36/52 (69%), Positives = 48/52 (92%) Frame = -3 Query: 745 MKTVSGKVVSTKPVNLSKAANILSNFVTSDNGASQSVSAYLRRASTAFNELV 590 MKTV+GK+VS+ PV++SKAA+ILS FV ++ GASQ+V+AYLRRA+TAF+ELV Sbjct: 1 MKTVTGKIVSSNPVSISKAASILSMFVAAETGASQAVAAYLRRATTAFDELV 52 >gb|ABK28002.1| unknown [Arabidopsis thaliana] Length = 97 Score = 72.8 bits (177), Expect = 1e-10 Identities = 37/51 (72%), Positives = 44/51 (86%) Frame = -3 Query: 745 MKTVSGKVVSTKPVNLSKAANILSNFVTSDNGASQSVSAYLRRASTAFNEL 593 MKTV+G+V S KP++LSKAA +LS FV+S+NGASQ VSAYLRRAS AF EL Sbjct: 1 MKTVTGRVNSAKPISLSKAATLLSGFVSSENGASQDVSAYLRRASGAFIEL 51 >ref|NP_001117602.1| uncharacterized protein [Arabidopsis thaliana] gi|98961959|gb|ABF59309.1| unknown protein [Arabidopsis thaliana] gi|332197581|gb|AEE35702.1| uncharacterized protein [Arabidopsis thaliana] Length = 96 Score = 72.8 bits (177), Expect = 1e-10 Identities = 37/51 (72%), Positives = 44/51 (86%) Frame = -3 Query: 745 MKTVSGKVVSTKPVNLSKAANILSNFVTSDNGASQSVSAYLRRASTAFNEL 593 MKTV+G+V S KP++LSKAA +LS FV+S+NGASQ VSAYLRRAS AF EL Sbjct: 1 MKTVTGRVNSAKPISLSKAATLLSGFVSSENGASQDVSAYLRRASGAFIEL 51