BLASTX nr result
ID: Atractylodes22_contig00010688
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00010688 (565 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFW81346.1| hypothetical protein ZEAMMB73_015937 [Zea mays] 136 2e-30 gb|AFW81342.1| spliceosome RNA helicase BAT1 isoform 1 [Zea mays... 136 2e-30 ref|XP_003569187.1| PREDICTED: DEAD-box ATP-dependent RNA helica... 136 2e-30 ref|XP_003569186.1| PREDICTED: DEAD-box ATP-dependent RNA helica... 136 2e-30 ref|XP_003569181.1| PREDICTED: DEAD-box ATP-dependent RNA helica... 136 2e-30 >gb|AFW81346.1| hypothetical protein ZEAMMB73_015937 [Zea mays] Length = 344 Score = 136 bits (343), Expect = 2e-30 Identities = 67/68 (98%), Positives = 68/68 (100%) Frame = -1 Query: 565 VINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSAADSDVLNQVQERFEVDIKELPEQI 386 VINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSA+DSDVLNQVQERFEVDIKELPEQI Sbjct: 277 VINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQERFEVDIKELPEQI 336 Query: 385 DTSTYMPS 362 DTSTYMPS Sbjct: 337 DTSTYMPS 344 >gb|AFW81342.1| spliceosome RNA helicase BAT1 isoform 1 [Zea mays] gi|413948694|gb|AFW81343.1| spliceosome RNA helicase BAT1 isoform 2 [Zea mays] gi|413948695|gb|AFW81344.1| spliceosome RNA helicase BAT1 isoform 3 [Zea mays] Length = 429 Score = 136 bits (343), Expect = 2e-30 Identities = 67/68 (98%), Positives = 68/68 (100%) Frame = -1 Query: 565 VINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSAADSDVLNQVQERFEVDIKELPEQI 386 VINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSA+DSDVLNQVQERFEVDIKELPEQI Sbjct: 362 VINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQERFEVDIKELPEQI 421 Query: 385 DTSTYMPS 362 DTSTYMPS Sbjct: 422 DTSTYMPS 429 >ref|XP_003569187.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like [Brachypodium distachyon] Length = 428 Score = 136 bits (343), Expect = 2e-30 Identities = 67/68 (98%), Positives = 68/68 (100%) Frame = -1 Query: 565 VINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSAADSDVLNQVQERFEVDIKELPEQI 386 VINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSA+DSDVLNQVQERFEVDIKELPEQI Sbjct: 361 VINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQERFEVDIKELPEQI 420 Query: 385 DTSTYMPS 362 DTSTYMPS Sbjct: 421 DTSTYMPS 428 >ref|XP_003569186.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like [Brachypodium distachyon] Length = 429 Score = 136 bits (343), Expect = 2e-30 Identities = 67/68 (98%), Positives = 68/68 (100%) Frame = -1 Query: 565 VINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSAADSDVLNQVQERFEVDIKELPEQI 386 VINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSA+DSDVLNQVQERFEVDIKELPEQI Sbjct: 362 VINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQERFEVDIKELPEQI 421 Query: 385 DTSTYMPS 362 DTSTYMPS Sbjct: 422 DTSTYMPS 429 >ref|XP_003569181.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like [Brachypodium distachyon] Length = 428 Score = 136 bits (343), Expect = 2e-30 Identities = 67/68 (98%), Positives = 68/68 (100%) Frame = -1 Query: 565 VINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSAADSDVLNQVQERFEVDIKELPEQI 386 VINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSA+DSDVLNQVQERFEVDIKELPEQI Sbjct: 361 VINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQERFEVDIKELPEQI 420 Query: 385 DTSTYMPS 362 DTSTYMPS Sbjct: 421 DTSTYMPS 428