BLASTX nr result
ID: Atractylodes22_contig00010476
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00010476 (291 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002535202.1| conserved hypothetical protein [Ricinus comm... 55 5e-06 >ref|XP_002535202.1| conserved hypothetical protein [Ricinus communis] gi|223523749|gb|EEF27181.1| conserved hypothetical protein [Ricinus communis] Length = 282 Score = 55.5 bits (132), Expect = 5e-06 Identities = 29/61 (47%), Positives = 38/61 (62%), Gaps = 3/61 (4%) Frame = -2 Query: 209 KKQCAGTGLFWPWRSCNDPPKSMKKPECSPPHLPARMAQPFNKNMDPIIPQAQ---PKIH 39 K++CAGTG+F P R P ++ KKP CS LPAR+ Q N N+D I PQ Q P+ + Sbjct: 216 KRECAGTGVFLP-RRVGAPTETRKKPACSTVLLPARVVQALNLNLDDISPQPQYQPPRFN 274 Query: 38 G 36 G Sbjct: 275 G 275