BLASTX nr result
ID: Atractylodes22_contig00010366
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00010366 (340 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002270546.2| PREDICTED: LOW QUALITY PROTEIN: pentatricope... 127 7e-28 ref|XP_002514778.1| pentatricopeptide repeat-containing protein,... 124 1e-26 ref|XP_002300357.1| predicted protein [Populus trichocarpa] gi|2... 117 7e-25 ref|XP_004138984.1| PREDICTED: pentatricopeptide repeat-containi... 102 3e-20 ref|XP_003542095.1| PREDICTED: pentatricopeptide repeat-containi... 99 3e-19 >ref|XP_002270546.2| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At3g02650, mitochondrial-like [Vitis vinifera] Length = 509 Score = 127 bits (320), Expect = 7e-28 Identities = 62/113 (54%), Positives = 84/113 (74%) Frame = +2 Query: 2 GYEVYNKFGDFLCATNADSYYFTIEALCRRSIFDRVGLVCERMLSEEKIPETGKVGNIIC 181 G EV+N FG++ C NADSYYFTIEALCRRSIFD VCE+ML+ +P++ KV NII Sbjct: 242 GLEVFNAFGEYGCEPNADSYYFTIEALCRRSIFDWALSVCEKMLNASSLPDSEKVWNIIS 301 Query: 182 YLCKAGFVKEAHSVYLLAKEKQRYPAQSSVNFLISSLCDRKKNDPGSVHLALK 340 + CK VK+A+ VYLLAKEK +YP +++VNFLI+SLC + G++ +A++ Sbjct: 302 WFCKGRKVKDAYLVYLLAKEKNKYPPKTTVNFLIASLC----REDGTISMAVE 350 >ref|XP_002514778.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223545829|gb|EEF47332.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 584 Score = 124 bits (310), Expect = 1e-26 Identities = 60/112 (53%), Positives = 80/112 (71%) Frame = +2 Query: 5 YEVYNKFGDFLCATNADSYYFTIEALCRRSIFDRVGLVCERMLSEEKIPETGKVGNIICY 184 +EV+NKFGDF C ++++Y++TIEALCRRSIFD V E+ML E +P+T K+G IIC+ Sbjct: 262 FEVFNKFGDFGCVPDSETYHYTIEALCRRSIFDWASSVREKMLRAEALPDTEKIGKIICW 321 Query: 185 LCKAGFVKEAHSVYLLAKEKQRYPAQSSVNFLISSLCDRKKNDPGSVHLALK 340 CK +A+ VYLLAKEK +YP Q SVNFLI LC + + +V LAL+ Sbjct: 322 FCKGDKANDAYLVYLLAKEKNKYPPQPSVNFLIGLLCQKNE----TVKLALE 369 >ref|XP_002300357.1| predicted protein [Populus trichocarpa] gi|222847615|gb|EEE85162.1| predicted protein [Populus trichocarpa] Length = 476 Score = 117 bits (294), Expect = 7e-25 Identities = 55/111 (49%), Positives = 79/111 (71%) Frame = +2 Query: 8 EVYNKFGDFLCATNADSYYFTIEALCRRSIFDRVGLVCERMLSEEKIPETGKVGNIICYL 187 EV++K DF C ++++YY+TIEALCRRS +D +VCE+ML + +P++ K+G IIC+ Sbjct: 155 EVFDKSKDFGCVPDSETYYYTIEALCRRSFYDWAWIVCEKMLDQGPLPDSEKIGKIICWF 214 Query: 188 CKAGFVKEAHSVYLLAKEKQRYPAQSSVNFLISSLCDRKKNDPGSVHLALK 340 CK K+AH VYLLAKEK + P + ++ FLI SLC D G+V+LAL+ Sbjct: 215 CKGSKAKDAHKVYLLAKEKSKCPPKPALYFLIGSLC----RDDGTVNLALE 261 >ref|XP_004138984.1| PREDICTED: pentatricopeptide repeat-containing protein At3g02650, mitochondrial-like [Cucumis sativus] gi|449477884|ref|XP_004155152.1| PREDICTED: pentatricopeptide repeat-containing protein At3g02650, mitochondrial-like [Cucumis sativus] Length = 479 Score = 102 bits (254), Expect = 3e-20 Identities = 56/111 (50%), Positives = 67/111 (60%) Frame = +2 Query: 8 EVYNKFGDFLCATNADSYYFTIEALCRRSIFDRVGLVCERMLSEEKIPETGKVGNIICYL 187 EV N + C NA+SYYFT+EALCRRS +D VCE+ML +PE+ +VG II Sbjct: 157 EVLNSYEVLGCVPNAESYYFTVEALCRRSSYDLAWPVCEKMLDSGSMPESNRVGKIISLF 216 Query: 188 CKAGFVKEAHSVYLLAKEKQRYPAQSSVNFLISSLCDRKKNDPGSVHLALK 340 CK K AHSVYLLAKEK Q +N LI SLC D +V LAL+ Sbjct: 217 CKGNKAKNAHSVYLLAKEKHVNLPQCYMNILIHSLC----RDDETVKLALE 263 >ref|XP_003542095.1| PREDICTED: pentatricopeptide repeat-containing protein At3g02650, mitochondrial-like [Glycine max] Length = 539 Score = 99.4 bits (246), Expect = 3e-19 Identities = 47/96 (48%), Positives = 64/96 (66%) Frame = +2 Query: 8 EVYNKFGDFLCATNADSYYFTIEALCRRSIFDRVGLVCERMLSEEKIPETGKVGNIICYL 187 EV++KF F C +AD+YYFTIEALCRR FD VC++M+ +P+ KVG I+ +L Sbjct: 217 EVFDKFEAFHCVPDADTYYFTIEALCRRRAFDWACGVCQKMVDARTLPDAEKVGAILSWL 276 Query: 188 CKAGFVKEAHSVYLLAKEKQRYPAQSSVNFLISSLC 295 CK KEAH VY++A EK + P + V+FL+ LC Sbjct: 277 CKGKKAKEAHGVYVVATEKGKLPPVNVVSFLVLKLC 312