BLASTX nr result
ID: Atractylodes22_contig00010341
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00010341 (763 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002267052.1| PREDICTED: glutaredoxin-C5, chloroplastic-li... 202 5e-50 emb|CBI37229.3| unnamed protein product [Vitis vinifera] 195 1e-47 pdb|3FZ9|A Chain A, Crystal Structure Of Poplar Glutaredoxin S12... 190 2e-46 gb|ACJ60637.1| glutaredoxin S12 [Populus tremula x Populus tremu... 190 2e-46 gb|ACF74281.1| electron transporter/thiol-disulfide exchange int... 189 6e-46 >ref|XP_002267052.1| PREDICTED: glutaredoxin-C5, chloroplastic-like [Vitis vinifera] Length = 178 Score = 202 bits (515), Expect = 5e-50 Identities = 96/117 (82%), Positives = 108/117 (92%) Frame = +2 Query: 227 RKHGALKIHAMTASFGSRLEETVKKTITDNPVVVYSKTWCSYSSEVKSLFNRLGVQPLVV 406 R++G + + AM +SFGSRLEETVKKT+ +NPVVVYSKTWCSYSSEVKSLF RLGV+P V+ Sbjct: 55 RRYGPVLVRAMASSFGSRLEETVKKTVDENPVVVYSKTWCSYSSEVKSLFKRLGVEPFVI 114 Query: 407 ELDQMGAQGPQLQKVLERLTGQHTVPNVFIGGKHIGGCTDTVKLHRKGELEALLAEA 577 ELD+MG QGPQLQKVLERLTGQHTVPNVFIGGKHIGGCTDTVKL+RKGELE LL+EA Sbjct: 115 ELDEMGPQGPQLQKVLERLTGQHTVPNVFIGGKHIGGCTDTVKLYRKGELEPLLSEA 171 >emb|CBI37229.3| unnamed protein product [Vitis vinifera] Length = 114 Score = 195 bits (495), Expect = 1e-47 Identities = 93/107 (86%), Positives = 101/107 (94%) Frame = +2 Query: 257 MTASFGSRLEETVKKTITDNPVVVYSKTWCSYSSEVKSLFNRLGVQPLVVELDQMGAQGP 436 M +SFGSRLEETVKKT+ +NPVVVYSKTWCSYSSEVKSLF RLGV+P V+ELD+MG QGP Sbjct: 1 MASSFGSRLEETVKKTVDENPVVVYSKTWCSYSSEVKSLFKRLGVEPFVIELDEMGPQGP 60 Query: 437 QLQKVLERLTGQHTVPNVFIGGKHIGGCTDTVKLHRKGELEALLAEA 577 QLQKVLERLTGQHTVPNVFIGGKHIGGCTDTVKL+RKGELE LL+EA Sbjct: 61 QLQKVLERLTGQHTVPNVFIGGKHIGGCTDTVKLYRKGELEPLLSEA 107 >pdb|3FZ9|A Chain A, Crystal Structure Of Poplar Glutaredoxin S12 In Complex With Glutathione gi|224036433|pdb|3FZA|A Chain A, Crystal Structure Of Poplar Glutaredoxin S12 In Complex With Glutathione And Beta-Mercaptoethanol Length = 112 Score = 190 bits (483), Expect = 2e-46 Identities = 91/105 (86%), Positives = 99/105 (94%) Frame = +2 Query: 263 ASFGSRLEETVKKTITDNPVVVYSKTWCSYSSEVKSLFNRLGVQPLVVELDQMGAQGPQL 442 ASFGSRLE+ VKKT+ +NPVVVYSKTWCSYSSEVKSLF RL V PLVVELD++GAQGPQ+ Sbjct: 1 ASFGSRLEDAVKKTVAENPVVVYSKTWCSYSSEVKSLFKRLNVDPLVVELDELGAQGPQI 60 Query: 443 QKVLERLTGQHTVPNVFIGGKHIGGCTDTVKLHRKGELEALLAEA 577 QKVLERLTGQHTVPNVFIGGKHIGGCTDTVKL+RKGELE LL+EA Sbjct: 61 QKVLERLTGQHTVPNVFIGGKHIGGCTDTVKLYRKGELEPLLSEA 105 >gb|ACJ60637.1| glutaredoxin S12 [Populus tremula x Populus tremuloides] Length = 185 Score = 190 bits (483), Expect = 2e-46 Identities = 96/133 (72%), Positives = 113/133 (84%), Gaps = 8/133 (6%) Frame = +2 Query: 203 SSRRILTI---RKHGALKIHAM-----TASFGSRLEETVKKTITDNPVVVYSKTWCSYSS 358 +S RIL+I +++ + + A ++SFGSRLE+ VKKT+ +NPVVVYSKTWCSYSS Sbjct: 46 TSSRILSINGPKRYRPMAVRATDSSSPSSSFGSRLEDAVKKTVAENPVVVYSKTWCSYSS 105 Query: 359 EVKSLFNRLGVQPLVVELDQMGAQGPQLQKVLERLTGQHTVPNVFIGGKHIGGCTDTVKL 538 EVKSLF RL V PLVVELD++GAQGPQ+QKVLERLTGQHTVPNVFIGGKHIGGCTDTVKL Sbjct: 106 EVKSLFKRLNVDPLVVELDELGAQGPQIQKVLERLTGQHTVPNVFIGGKHIGGCTDTVKL 165 Query: 539 HRKGELEALLAEA 577 +RKGELE LL+EA Sbjct: 166 YRKGELEPLLSEA 178 >gb|ACF74281.1| electron transporter/thiol-disulfide exchange intermediate protein [Arachis hypogaea] Length = 187 Score = 189 bits (480), Expect = 6e-46 Identities = 89/106 (83%), Positives = 101/106 (95%) Frame = +2 Query: 260 TASFGSRLEETVKKTITDNPVVVYSKTWCSYSSEVKSLFNRLGVQPLVVELDQMGAQGPQ 439 ++SFGSRLEET+KKT++ NPVVVYSKTWCSYSSEVK+LF +LGV+PLV ELD+MG QGPQ Sbjct: 76 SSSFGSRLEETIKKTVSGNPVVVYSKTWCSYSSEVKALFKKLGVEPLVFELDEMGPQGPQ 135 Query: 440 LQKVLERLTGQHTVPNVFIGGKHIGGCTDTVKLHRKGELEALLAEA 577 LQKVLERLTGQHTVPNVFIGGKHIGGCTDT+KL+RKGELE LL+EA Sbjct: 136 LQKVLERLTGQHTVPNVFIGGKHIGGCTDTLKLYRKGELEPLLSEA 181