BLASTX nr result
ID: Atractylodes22_contig00009769
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00009769 (316 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002530987.1| conserved hypothetical protein [Ricinus comm... 86 2e-15 ref|XP_004167131.1| PREDICTED: uncharacterized protein At2g37660... 84 9e-15 ref|XP_004142064.1| PREDICTED: uncharacterized protein At2g37660... 84 9e-15 gb|AFM52663.1| putative NAD-dependent dehydrogenase 2 [Erythroxy... 84 9e-15 gb|AFK40676.1| unknown [Lotus japonicus] 84 1e-14 >ref|XP_002530987.1| conserved hypothetical protein [Ricinus communis] gi|223529439|gb|EEF31399.1| conserved hypothetical protein [Ricinus communis] Length = 323 Score = 86.3 bits (212), Expect = 2e-15 Identities = 42/46 (91%), Positives = 44/46 (95%) Frame = -1 Query: 316 VAEVCIQALQFEEAKHKAFDLASKPEGSGTPTTDFKALFSQVTTRF 179 VAEVCIQALQFEEAK KAFDLASKPEG+G+PT DFKALFSQVTTRF Sbjct: 278 VAEVCIQALQFEEAKFKAFDLASKPEGTGSPTKDFKALFSQVTTRF 323 >ref|XP_004167131.1| PREDICTED: uncharacterized protein At2g37660, chloroplastic-like, partial [Cucumis sativus] Length = 236 Score = 84.3 bits (207), Expect = 9e-15 Identities = 42/46 (91%), Positives = 42/46 (91%) Frame = -1 Query: 316 VAEVCIQALQFEEAKHKAFDLASKPEGSGTPTTDFKALFSQVTTRF 179 VAEVCIQALQFEEAK KA DLASKPEG GTPT DFKALFSQVTTRF Sbjct: 191 VAEVCIQALQFEEAKFKALDLASKPEGVGTPTKDFKALFSQVTTRF 236 >ref|XP_004142064.1| PREDICTED: uncharacterized protein At2g37660, chloroplastic-like [Cucumis sativus] Length = 326 Score = 84.3 bits (207), Expect = 9e-15 Identities = 42/46 (91%), Positives = 42/46 (91%) Frame = -1 Query: 316 VAEVCIQALQFEEAKHKAFDLASKPEGSGTPTTDFKALFSQVTTRF 179 VAEVCIQALQFEEAK KA DLASKPEG GTPT DFKALFSQVTTRF Sbjct: 281 VAEVCIQALQFEEAKFKALDLASKPEGVGTPTKDFKALFSQVTTRF 326 >gb|AFM52663.1| putative NAD-dependent dehydrogenase 2 [Erythroxylum coca] Length = 253 Score = 84.3 bits (207), Expect = 9e-15 Identities = 40/46 (86%), Positives = 43/46 (93%) Frame = -1 Query: 316 VAEVCIQALQFEEAKHKAFDLASKPEGSGTPTTDFKALFSQVTTRF 179 VAEVCIQALQ+EEAK KAFDLASKPEG+GTPT DFKALFSQ+T RF Sbjct: 208 VAEVCIQALQYEEAKFKAFDLASKPEGTGTPTKDFKALFSQITARF 253 >gb|AFK40676.1| unknown [Lotus japonicus] Length = 313 Score = 84.0 bits (206), Expect = 1e-14 Identities = 40/46 (86%), Positives = 43/46 (93%) Frame = -1 Query: 316 VAEVCIQALQFEEAKHKAFDLASKPEGSGTPTTDFKALFSQVTTRF 179 VAEVCIQAL FEEA+ KAFDLASKPEG+GTPT DFKALFSQ+TTRF Sbjct: 268 VAEVCIQALNFEEAQFKAFDLASKPEGAGTPTRDFKALFSQITTRF 313