BLASTX nr result
ID: Atractylodes22_contig00009757
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00009757 (396 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003537017.1| PREDICTED: structural maintenance of chromos... 54 1e-05 >ref|XP_003537017.1| PREDICTED: structural maintenance of chromosomes protein 1A-like [Glycine max] Length = 1216 Score = 54.3 bits (129), Expect = 1e-05 Identities = 27/50 (54%), Positives = 33/50 (66%) Frame = +3 Query: 18 ISQQLLEGNAFQTITISRKASFYNNTEVLIGVYSDFETGGSRALAYDLRK 167 ISQ + GN FQ+I IS K +FY+ E L+GVY D E G SR L +DL K Sbjct: 1163 ISQDVDGGNGFQSIVISLKDTFYDKAEALVGVYRDSERGCSRTLTFDLTK 1212