BLASTX nr result
ID: Atractylodes22_contig00009745
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00009745 (402 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002529005.1| Non-imprinted in Prader-Willi/Angelman syndr... 60 1e-07 ref|NP_564447.1| uncharacterized protein [Arabidopsis thaliana] ... 58 7e-07 ref|XP_002891103.1| hypothetical protein ARALYDRAFT_473598 [Arab... 58 7e-07 ref|XP_002874581.1| hypothetical protein ARALYDRAFT_327146 [Arab... 58 7e-07 dbj|BAE99576.1| hypothetical protein [Arabidopsis thaliana] 58 7e-07 >ref|XP_002529005.1| Non-imprinted in Prader-Willi/Angelman syndrome region protein, putative [Ricinus communis] gi|223531545|gb|EEF33375.1| Non-imprinted in Prader-Willi/Angelman syndrome region protein, putative [Ricinus communis] Length = 345 Score = 60.5 bits (145), Expect = 1e-07 Identities = 27/34 (79%), Positives = 32/34 (94%) Frame = +3 Query: 300 MASQGWRDAYRGMSADNIKGLILALSSSLFIGAS 401 MA+Q WRD+Y+GMS+DNIKGL+LALSSS FIGAS Sbjct: 1 MATQSWRDSYKGMSSDNIKGLVLALSSSFFIGAS 34 >ref|NP_564447.1| uncharacterized protein [Arabidopsis thaliana] gi|8778257|gb|AAF79266.1|AC023279_15 F12K21.21 [Arabidopsis thaliana] gi|12323864|gb|AAG51905.1|AC023913_13 hypothetical protein; 4619-2435 [Arabidopsis thaliana] gi|89000981|gb|ABD59080.1| At1g34470 [Arabidopsis thaliana] gi|332193596|gb|AEE31717.1| uncharacterized protein [Arabidopsis thaliana] Length = 368 Score = 58.2 bits (139), Expect = 7e-07 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = +3 Query: 306 SQGWRDAYRGMSADNIKGLILALSSSLFIGAS 401 S WRDAY+GMS+DNIKGL+LALSSSLFIGAS Sbjct: 5 SGSWRDAYKGMSSDNIKGLVLALSSSLFIGAS 36 >ref|XP_002891103.1| hypothetical protein ARALYDRAFT_473598 [Arabidopsis lyrata subsp. lyrata] gi|297336945|gb|EFH67362.1| hypothetical protein ARALYDRAFT_473598 [Arabidopsis lyrata subsp. lyrata] Length = 368 Score = 58.2 bits (139), Expect = 7e-07 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = +3 Query: 306 SQGWRDAYRGMSADNIKGLILALSSSLFIGAS 401 S WRDAY+GMS+DNIKGL+LALSSSLFIGAS Sbjct: 5 SGSWRDAYKGMSSDNIKGLVLALSSSLFIGAS 36 >ref|XP_002874581.1| hypothetical protein ARALYDRAFT_327146 [Arabidopsis lyrata subsp. lyrata] gi|297320418|gb|EFH50840.1| hypothetical protein ARALYDRAFT_327146 [Arabidopsis lyrata subsp. lyrata] Length = 381 Score = 58.2 bits (139), Expect = 7e-07 Identities = 26/33 (78%), Positives = 31/33 (93%) Frame = +3 Query: 303 ASQGWRDAYRGMSADNIKGLILALSSSLFIGAS 401 +S WRDAY+GMS+DN+KGL+LALSSSLFIGAS Sbjct: 4 SSGSWRDAYKGMSSDNVKGLVLALSSSLFIGAS 36 >dbj|BAE99576.1| hypothetical protein [Arabidopsis thaliana] Length = 106 Score = 58.2 bits (139), Expect = 7e-07 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = +3 Query: 306 SQGWRDAYRGMSADNIKGLILALSSSLFIGAS 401 S WRDAY+GMS+DNIKGL+LALSSSLFIGAS Sbjct: 5 SGSWRDAYKGMSSDNIKGLVLALSSSLFIGAS 36