BLASTX nr result
ID: Atractylodes22_contig00009731
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00009731 (1173 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002525464.1| RNA binding protein, putative [Ricinus commu... 61 6e-10 ref|XP_002892494.1| RNA recognition motif-containing protein [Ar... 62 4e-09 ref|NP_172394.1| U11/U12 small nuclear ribonucleoprotein 65 kDa ... 62 2e-08 ref|XP_002270244.2| PREDICTED: RNA-binding protein 40-like [Viti... 61 2e-08 ref|XP_003548764.1| PREDICTED: uncharacterized protein LOC100818... 59 4e-08 >ref|XP_002525464.1| RNA binding protein, putative [Ricinus communis] gi|223535277|gb|EEF36954.1| RNA binding protein, putative [Ricinus communis] Length = 450 Score = 61.2 bits (147), Expect(2) = 6e-10 Identities = 27/33 (81%), Positives = 31/33 (93%) Frame = -1 Query: 1173 GRMRGQAFVTFPSIDIAHCALNLVNDFVFKGKP 1075 GRMRGQAFVTFPS+++AH ALNLVN +VFKGKP Sbjct: 403 GRMRGQAFVTFPSVELAHQALNLVNGYVFKGKP 435 Score = 29.6 bits (65), Expect(2) = 6e-10 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -2 Query: 1085 KASPMMIQFRRNTSAGKTN 1029 K PM+IQF RN SA KTN Sbjct: 432 KGKPMIIQFGRNPSASKTN 450 >ref|XP_002892494.1| RNA recognition motif-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297338336|gb|EFH68753.1| RNA recognition motif-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 438 Score = 61.6 bits (148), Expect(2) = 4e-09 Identities = 27/33 (81%), Positives = 31/33 (93%) Frame = -1 Query: 1173 GRMRGQAFVTFPSIDIAHCALNLVNDFVFKGKP 1075 GRMRGQAF+TFPS+++AH ALNLVN FVFKGKP Sbjct: 390 GRMRGQAFLTFPSVEVAHRALNLVNGFVFKGKP 422 Score = 26.6 bits (57), Expect(2) = 4e-09 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = -2 Query: 1085 KASPMMIQFRRNTSAGKTND 1026 K PM+IQF RN A K N+ Sbjct: 419 KGKPMIIQFGRNPGAAKPNE 438 >ref|NP_172394.1| U11/U12 small nuclear ribonucleoprotein 65 kDa protein [Arabidopsis thaliana] gi|20258828|gb|AAM13896.1| unknown protein [Arabidopsis thaliana] gi|21689717|gb|AAM67480.1| unknown protein [Arabidopsis thaliana] gi|332190295|gb|AEE28416.1| U11/U12 small nuclear ribonucleoprotein 65 kDa protein [Arabidopsis thaliana] Length = 442 Score = 61.6 bits (148), Expect(2) = 2e-08 Identities = 27/33 (81%), Positives = 31/33 (93%) Frame = -1 Query: 1173 GRMRGQAFVTFPSIDIAHCALNLVNDFVFKGKP 1075 GRMRGQAF+TFPS+++AH ALNLVN FVFKGKP Sbjct: 394 GRMRGQAFLTFPSVEVAHRALNLVNGFVFKGKP 426 Score = 24.3 bits (51), Expect(2) = 2e-08 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = -2 Query: 1085 KASPMMIQFRRNTSAGKTND 1026 K PM+IQF R A K N+ Sbjct: 423 KGKPMIIQFGRTPGAAKPNE 442 >ref|XP_002270244.2| PREDICTED: RNA-binding protein 40-like [Vitis vinifera] gi|298205172|emb|CBI17231.3| unnamed protein product [Vitis vinifera] Length = 463 Score = 61.2 bits (147), Expect(2) = 2e-08 Identities = 27/33 (81%), Positives = 31/33 (93%) Frame = -1 Query: 1173 GRMRGQAFVTFPSIDIAHCALNLVNDFVFKGKP 1075 GRMRGQAFVTFPS+++AH ALNLVN +VFKGKP Sbjct: 416 GRMRGQAFVTFPSVELAHHALNLVNGYVFKGKP 448 Score = 24.3 bits (51), Expect(2) = 2e-08 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = -2 Query: 1085 KASPMMIQFRRNTSAGK 1035 K PM+IQF RN +A K Sbjct: 445 KGKPMIIQFGRNPAAAK 461 >ref|XP_003548764.1| PREDICTED: uncharacterized protein LOC100818499 [Glycine max] Length = 456 Score = 58.9 bits (141), Expect(2) = 4e-08 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = -1 Query: 1173 GRMRGQAFVTFPSIDIAHCALNLVNDFVFKGKP 1075 GRMRGQAF+TFPSI++AH ALNLVN +V KGKP Sbjct: 409 GRMRGQAFITFPSIELAHHALNLVNGYVLKGKP 441 Score = 25.8 bits (55), Expect(2) = 4e-08 Identities = 11/18 (61%), Positives = 13/18 (72%) Frame = -2 Query: 1088 LKASPMMIQFRRNTSAGK 1035 LK PM+IQF RN +A K Sbjct: 437 LKGKPMIIQFGRNPAAAK 454