BLASTX nr result
ID: Atractylodes22_contig00009350
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00009350 (250 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002533273.1| conserved hypothetical protein [Ricinus comm... 75 5e-12 ref|XP_002274448.2| PREDICTED: uncharacterized membrane protein ... 68 7e-10 gb|ACJ84546.1| unknown [Medicago truncatula] gi|388519313|gb|AFK... 65 4e-09 ref|XP_003611897.1| Membrane protein, putative [Medicago truncat... 64 1e-08 ref|XP_003611896.1| Membrane protein, putative [Medicago truncat... 64 1e-08 >ref|XP_002533273.1| conserved hypothetical protein [Ricinus communis] gi|223526898|gb|EEF29105.1| conserved hypothetical protein [Ricinus communis] Length = 377 Score = 75.1 bits (183), Expect = 5e-12 Identities = 42/86 (48%), Positives = 53/86 (61%), Gaps = 4/86 (4%) Frame = +3 Query: 3 ILVLQSLYYDHIYAWLISQKAYASAGPEVEEAKKPLKP----TNLNSPSRAIRTSPSHRR 170 +LVLQ LYYD+IY W QK +VE+ KKPLKP + + P+ + R++P RR Sbjct: 106 VLVLQGLYYDYIYRWWKGQK--NEVNQQVEDEKKPLKPKLGDSGIPIPNASTRSTP--RR 161 Query: 171 NYYYMSARSMAGSATPPNSAYLWTTR 248 YYY SARSMA S TPP YL T + Sbjct: 162 EYYYTSARSMASSGTPPFRGYLRTAK 187 >ref|XP_002274448.2| PREDICTED: uncharacterized membrane protein YOL092W-like [Vitis vinifera] gi|297735218|emb|CBI17580.3| unnamed protein product [Vitis vinifera] Length = 381 Score = 68.2 bits (165), Expect = 7e-10 Identities = 39/86 (45%), Positives = 53/86 (61%), Gaps = 4/86 (4%) Frame = +3 Query: 3 ILVLQSLYYDHIYAWLISQKAYASAGPEVEEAKKPLKP----TNLNSPSRAIRTSPSHRR 170 +LVLQS+YYD IY W + ++ VEE +KPLKP + + P+ ++ S R Sbjct: 106 VLVLQSVYYDDIYPWW--KYGQINSNQVVEEERKPLKPKAGGSGIPIPNTPVKAG-STLR 162 Query: 171 NYYYMSARSMAGSATPPNSAYLWTTR 248 +YYY SARS+AGS TPP +YL T R Sbjct: 163 DYYYTSARSLAGSTTPPFRSYLRTAR 188 >gb|ACJ84546.1| unknown [Medicago truncatula] gi|388519313|gb|AFK47718.1| unknown [Medicago truncatula] Length = 380 Score = 65.5 bits (158), Expect = 4e-09 Identities = 36/81 (44%), Positives = 48/81 (59%), Gaps = 3/81 (3%) Frame = +3 Query: 3 ILVLQSLYYDHIYAWLISQKAYASAGPEVEEAKKPLKPTN---LNSPSRAIRTSPSHRRN 173 +LV+QSLYYD+IY W ++ + EE KKPLKP L P R+ R + Sbjct: 106 VLVVQSLYYDYIYKWC-KRRQKINIEETYEEEKKPLKPKERFELGIPIRSGRHRAIPKPE 164 Query: 174 YYYMSARSMAGSATPPNSAYL 236 YYY SARS+AG+ TPP+ Y+ Sbjct: 165 YYYGSARSLAGNVTPPSRTYM 185 >ref|XP_003611897.1| Membrane protein, putative [Medicago truncatula] gi|355513232|gb|AES94855.1| Membrane protein, putative [Medicago truncatula] Length = 380 Score = 63.9 bits (154), Expect = 1e-08 Identities = 35/81 (43%), Positives = 47/81 (58%), Gaps = 3/81 (3%) Frame = +3 Query: 3 ILVLQSLYYDHIYAWLISQKAYASAGPEVEEAKKPLKPTN---LNSPSRAIRTSPSHRRN 173 +LV+QS YYD+IY W ++ + EE KKPLKP L P R+ R + Sbjct: 106 VLVVQSFYYDYIYKWC-KRRQKINIEETYEEEKKPLKPKERFELGIPIRSGRHRAIPKPE 164 Query: 174 YYYMSARSMAGSATPPNSAYL 236 YYY SARS+AG+ TPP+ Y+ Sbjct: 165 YYYGSARSLAGNVTPPSRTYM 185 >ref|XP_003611896.1| Membrane protein, putative [Medicago truncatula] gi|355513231|gb|AES94854.1| Membrane protein, putative [Medicago truncatula] Length = 382 Score = 63.9 bits (154), Expect = 1e-08 Identities = 35/81 (43%), Positives = 47/81 (58%), Gaps = 3/81 (3%) Frame = +3 Query: 3 ILVLQSLYYDHIYAWLISQKAYASAGPEVEEAKKPLKPTN---LNSPSRAIRTSPSHRRN 173 +LV+QS YYD+IY W ++ + EE KKPLKP L P R+ R + Sbjct: 106 VLVVQSFYYDYIYKWC-KRRQKINIEETYEEEKKPLKPKERFELGIPIRSGRHRAIPKPE 164 Query: 174 YYYMSARSMAGSATPPNSAYL 236 YYY SARS+AG+ TPP+ Y+ Sbjct: 165 YYYGSARSLAGNVTPPSRTYM 185