BLASTX nr result
ID: Atractylodes22_contig00009301
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00009301 (236 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003595581.1| Polyadenylate-binding protein [Medicago trun... 71 2e-12 ref|XP_003546575.1| PREDICTED: protein MEI2-like 2-like [Glycine... 71 2e-12 ref|XP_003533847.1| PREDICTED: protein MEI2-like 2-like [Glycine... 71 2e-12 ref|XP_003595582.1| Polyadenylate-binding protein [Medicago trun... 71 2e-12 ref|XP_002519750.1| RNA-binding protein, putative [Ricinus commu... 71 2e-12 >ref|XP_003595581.1| Polyadenylate-binding protein [Medicago truncatula] gi|47834691|gb|AAT38999.1| AML5 [Medicago truncatula] gi|87241360|gb|ABD33218.1| RNA-binding region RNP-1 (RNA recognition motif); RNA recognition motif 2 [Medicago truncatula] gi|355484629|gb|AES65832.1| Polyadenylate-binding protein [Medicago truncatula] Length = 865 Score = 70.9 bits (172), Expect(2) = 2e-12 Identities = 34/36 (94%), Positives = 34/36 (94%) Frame = +2 Query: 128 DNPSDKDINQGTLVVFNLDPSVSCEDLLQIFGAYGE 235 DNPSDKDINQGTLVVFNLDPSVS EDL QIFGAYGE Sbjct: 271 DNPSDKDINQGTLVVFNLDPSVSNEDLRQIFGAYGE 306 Score = 25.8 bits (55), Expect(2) = 2e-12 Identities = 10/11 (90%), Positives = 11/11 (100%) Frame = +1 Query: 1 RKLDIHYSIPK 33 RKLDIH+SIPK Sbjct: 260 RKLDIHFSIPK 270 >ref|XP_003546575.1| PREDICTED: protein MEI2-like 2-like [Glycine max] Length = 862 Score = 70.9 bits (172), Expect(2) = 2e-12 Identities = 34/36 (94%), Positives = 34/36 (94%) Frame = +2 Query: 128 DNPSDKDINQGTLVVFNLDPSVSCEDLLQIFGAYGE 235 DNPSDKDINQGTLVVFNLDPSVS EDL QIFGAYGE Sbjct: 269 DNPSDKDINQGTLVVFNLDPSVSNEDLRQIFGAYGE 304 Score = 25.8 bits (55), Expect(2) = 2e-12 Identities = 10/11 (90%), Positives = 11/11 (100%) Frame = +1 Query: 1 RKLDIHYSIPK 33 RKLDIH+SIPK Sbjct: 258 RKLDIHFSIPK 268 >ref|XP_003533847.1| PREDICTED: protein MEI2-like 2-like [Glycine max] Length = 862 Score = 70.9 bits (172), Expect(2) = 2e-12 Identities = 34/36 (94%), Positives = 34/36 (94%) Frame = +2 Query: 128 DNPSDKDINQGTLVVFNLDPSVSCEDLLQIFGAYGE 235 DNPSDKDINQGTLVVFNLDPSVS EDL QIFGAYGE Sbjct: 269 DNPSDKDINQGTLVVFNLDPSVSNEDLRQIFGAYGE 304 Score = 25.8 bits (55), Expect(2) = 2e-12 Identities = 10/11 (90%), Positives = 11/11 (100%) Frame = +1 Query: 1 RKLDIHYSIPK 33 RKLDIH+SIPK Sbjct: 258 RKLDIHFSIPK 268 >ref|XP_003595582.1| Polyadenylate-binding protein [Medicago truncatula] gi|355484630|gb|AES65833.1| Polyadenylate-binding protein [Medicago truncatula] Length = 764 Score = 70.9 bits (172), Expect(2) = 2e-12 Identities = 34/36 (94%), Positives = 34/36 (94%) Frame = +2 Query: 128 DNPSDKDINQGTLVVFNLDPSVSCEDLLQIFGAYGE 235 DNPSDKDINQGTLVVFNLDPSVS EDL QIFGAYGE Sbjct: 170 DNPSDKDINQGTLVVFNLDPSVSNEDLRQIFGAYGE 205 Score = 25.8 bits (55), Expect(2) = 2e-12 Identities = 10/11 (90%), Positives = 11/11 (100%) Frame = +1 Query: 1 RKLDIHYSIPK 33 RKLDIH+SIPK Sbjct: 159 RKLDIHFSIPK 169 >ref|XP_002519750.1| RNA-binding protein, putative [Ricinus communis] gi|223541167|gb|EEF42723.1| RNA-binding protein, putative [Ricinus communis] Length = 723 Score = 70.9 bits (172), Expect(2) = 2e-12 Identities = 34/36 (94%), Positives = 34/36 (94%) Frame = +2 Query: 128 DNPSDKDINQGTLVVFNLDPSVSCEDLLQIFGAYGE 235 DNPSDKDINQGTLVVFNLDPSVS EDL QIFGAYGE Sbjct: 274 DNPSDKDINQGTLVVFNLDPSVSNEDLRQIFGAYGE 309 Score = 25.8 bits (55), Expect(2) = 2e-12 Identities = 10/11 (90%), Positives = 11/11 (100%) Frame = +1 Query: 1 RKLDIHYSIPK 33 RKLDIH+SIPK Sbjct: 263 RKLDIHFSIPK 273