BLASTX nr result
ID: Atractylodes22_contig00009265
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00009265 (233 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002268494.2| PREDICTED: zinc finger protein VAR3, chlorop... 58 7e-07 emb|CBI31208.3| unnamed protein product [Vitis vinifera] 58 7e-07 >ref|XP_002268494.2| PREDICTED: zinc finger protein VAR3, chloroplastic-like [Vitis vinifera] Length = 879 Score = 58.2 bits (139), Expect = 7e-07 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = +3 Query: 135 PEIKNVRNGWEGKSLEGSAVKETDPLDMSEEAK 233 P+ +NVR GW GKSLEGSAVKE DPLDMSEEAK Sbjct: 772 PKNQNVRQGWTGKSLEGSAVKEPDPLDMSEEAK 804 >emb|CBI31208.3| unnamed protein product [Vitis vinifera] Length = 676 Score = 58.2 bits (139), Expect = 7e-07 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = +3 Query: 135 PEIKNVRNGWEGKSLEGSAVKETDPLDMSEEAK 233 P+ +NVR GW GKSLEGSAVKE DPLDMSEEAK Sbjct: 569 PKNQNVRQGWTGKSLEGSAVKEPDPLDMSEEAK 601