BLASTX nr result
ID: Atractylodes22_contig00009217
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00009217 (266 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI34587.3| unnamed protein product [Vitis vinifera] 69 5e-10 ref|XP_002280081.1| PREDICTED: mediator of RNA polymerase II tra... 69 5e-10 ref|XP_002303692.1| predicted protein [Populus trichocarpa] gi|2... 67 2e-09 ref|XP_002527873.1| nut2, putative [Ricinus communis] gi|2235327... 67 2e-09 ref|XP_002299427.1| predicted protein [Populus trichocarpa] gi|2... 66 3e-09 >emb|CBI34587.3| unnamed protein product [Vitis vinifera] Length = 284 Score = 68.6 bits (166), Expect = 5e-10 Identities = 33/40 (82%), Positives = 37/40 (92%) Frame = +3 Query: 3 FPDEVEDYREIRASSAAESIRLAQAQSILPNGDVKVKPEM 122 FPDEVE YREIRA+SAAES RLAQAQS+LPNGD+KVK E+ Sbjct: 245 FPDEVESYREIRAASAAESKRLAQAQSVLPNGDLKVKTEL 284 >ref|XP_002280081.1| PREDICTED: mediator of RNA polymerase II transcription subunit 10 [Vitis vinifera] Length = 194 Score = 68.6 bits (166), Expect = 5e-10 Identities = 33/40 (82%), Positives = 37/40 (92%) Frame = +3 Query: 3 FPDEVEDYREIRASSAAESIRLAQAQSILPNGDVKVKPEM 122 FPDEVE YREIRA+SAAES RLAQAQS+LPNGD+KVK E+ Sbjct: 155 FPDEVESYREIRAASAAESKRLAQAQSVLPNGDLKVKTEL 194 >ref|XP_002303692.1| predicted protein [Populus trichocarpa] gi|222841124|gb|EEE78671.1| predicted protein [Populus trichocarpa] Length = 185 Score = 67.0 bits (162), Expect = 2e-09 Identities = 33/39 (84%), Positives = 35/39 (89%) Frame = +3 Query: 3 FPDEVEDYREIRASSAAESIRLAQAQSILPNGDVKVKPE 119 FPDEVE YREIRA SAAE+ RLAQ+QS LPNGDVKVKPE Sbjct: 146 FPDEVESYREIRAMSAAEAKRLAQSQSSLPNGDVKVKPE 184 >ref|XP_002527873.1| nut2, putative [Ricinus communis] gi|223532724|gb|EEF34504.1| nut2, putative [Ricinus communis] Length = 187 Score = 66.6 bits (161), Expect = 2e-09 Identities = 34/40 (85%), Positives = 35/40 (87%) Frame = +3 Query: 3 FPDEVEDYREIRASSAAESIRLAQAQSILPNGDVKVKPEM 122 FPDEVE YREIRA SAAES RLAQAQS LPNGDVKVK E+ Sbjct: 148 FPDEVESYREIRAISAAESKRLAQAQSSLPNGDVKVKSEL 187 >ref|XP_002299427.1| predicted protein [Populus trichocarpa] gi|222846685|gb|EEE84232.1| predicted protein [Populus trichocarpa] Length = 190 Score = 65.9 bits (159), Expect = 3e-09 Identities = 33/40 (82%), Positives = 35/40 (87%) Frame = +3 Query: 3 FPDEVEDYREIRASSAAESIRLAQAQSILPNGDVKVKPEM 122 FPDEVE YREIRA SAAE+ RLAQAQS LPNGDVKVK E+ Sbjct: 151 FPDEVESYREIRAMSAAEAKRLAQAQSSLPNGDVKVKAEL 190