BLASTX nr result
ID: Atractylodes22_contig00009157
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00009157 (276 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002533809.1| conserved hypothetical protein [Ricinus comm... 109 5e-23 ref|XP_003520272.1| PREDICTED: uncharacterized membrane protein ... 109 9e-23 ref|XP_003548861.1| PREDICTED: uncharacterized membrane protein ... 109 9e-23 ref|XP_003612112.1| Transmembrane and coiled-coil domain-contain... 108 1e-22 ref|XP_003612113.1| Transmembrane and coiled-coil domain-contain... 108 3e-22 >ref|XP_002533809.1| conserved hypothetical protein [Ricinus communis] gi|223526263|gb|EEF28578.1| conserved hypothetical protein [Ricinus communis] Length = 713 Score = 109 bits (272), Expect(2) = 5e-23 Identities = 51/64 (79%), Positives = 57/64 (89%) Frame = -2 Query: 215 AAGAGLTGTKMARRT*GIDEFEFKAIGECHNHGRLAVEILVSGYVFEESDFLRPWEGQSD 36 AAGAGL GTKMARRT +DEFEFKAIGE HN GRLAVEILVSG+VF+E DF+RPWEGQ D Sbjct: 425 AAGAGLAGTKMARRTGNVDEFEFKAIGENHNQGRLAVEILVSGFVFDEEDFIRPWEGQID 484 Query: 35 NMEK 24 N+E+ Sbjct: 485 NLER 488 Score = 23.1 bits (48), Expect(2) = 5e-23 Identities = 8/16 (50%), Positives = 12/16 (75%) Frame = -3 Query: 49 KGKVITWKRYALQWES 2 +G++ +RY LQWES Sbjct: 480 EGQIDNLERYVLQWES 495 >ref|XP_003520272.1| PREDICTED: uncharacterized membrane protein F35D11.3-like [Glycine max] Length = 680 Score = 109 bits (272), Expect(2) = 9e-23 Identities = 50/64 (78%), Positives = 58/64 (90%) Frame = -2 Query: 215 AAGAGLTGTKMARRT*GIDEFEFKAIGECHNHGRLAVEILVSGYVFEESDFLRPWEGQSD 36 AAGAGLTG+KMARR G+DEFEFKAIGE HN GRL VEILVSG+VFE+ DF+RPWEGQ+D Sbjct: 390 AAGAGLTGSKMARRVGGVDEFEFKAIGENHNQGRLGVEILVSGFVFEKEDFIRPWEGQND 449 Query: 35 NMEK 24 N+E+ Sbjct: 450 NLER 453 Score = 22.3 bits (46), Expect(2) = 9e-23 Identities = 8/9 (88%), Positives = 9/9 (100%) Frame = -3 Query: 28 KRYALQWES 2 +RYALQWES Sbjct: 452 ERYALQWES 460 >ref|XP_003548861.1| PREDICTED: uncharacterized membrane protein F35D11.3-like [Glycine max] Length = 676 Score = 109 bits (272), Expect(2) = 9e-23 Identities = 50/64 (78%), Positives = 58/64 (90%) Frame = -2 Query: 215 AAGAGLTGTKMARRT*GIDEFEFKAIGECHNHGRLAVEILVSGYVFEESDFLRPWEGQSD 36 AAGAGLTG+KMARR G+DEFEFKAIGE HN GRL VEILVSG+VFE+ DF+RPWEGQ+D Sbjct: 388 AAGAGLTGSKMARRVGGVDEFEFKAIGENHNQGRLGVEILVSGFVFEKEDFIRPWEGQND 447 Query: 35 NMEK 24 N+E+ Sbjct: 448 NLER 451 Score = 22.3 bits (46), Expect(2) = 9e-23 Identities = 8/9 (88%), Positives = 9/9 (100%) Frame = -3 Query: 28 KRYALQWES 2 +RYALQWES Sbjct: 450 ERYALQWES 458 >ref|XP_003612112.1| Transmembrane and coiled-coil domain-containing protein [Medicago truncatula] gi|355513447|gb|AES95070.1| Transmembrane and coiled-coil domain-containing protein [Medicago truncatula] Length = 717 Score = 108 bits (271), Expect(2) = 1e-22 Identities = 50/64 (78%), Positives = 58/64 (90%) Frame = -2 Query: 215 AAGAGLTGTKMARRT*GIDEFEFKAIGECHNHGRLAVEILVSGYVFEESDFLRPWEGQSD 36 AAGAGLTGTKMARR +DEFEF+AIG+ HN GRLAVEILVSG+VFEE DF+RPWEGQ+D Sbjct: 384 AAGAGLTGTKMARRVGSVDEFEFRAIGDNHNQGRLAVEILVSGFVFEEDDFVRPWEGQND 443 Query: 35 NMEK 24 N+E+ Sbjct: 444 NLER 447 Score = 22.3 bits (46), Expect(2) = 1e-22 Identities = 8/9 (88%), Positives = 9/9 (100%) Frame = -3 Query: 28 KRYALQWES 2 +RYALQWES Sbjct: 446 ERYALQWES 454 >ref|XP_003612113.1| Transmembrane and coiled-coil domain-containing protein [Medicago truncatula] gi|355513448|gb|AES95071.1| Transmembrane and coiled-coil domain-containing protein [Medicago truncatula] Length = 447 Score = 108 bits (271), Expect = 3e-22 Identities = 50/64 (78%), Positives = 58/64 (90%) Frame = -2 Query: 215 AAGAGLTGTKMARRT*GIDEFEFKAIGECHNHGRLAVEILVSGYVFEESDFLRPWEGQSD 36 AAGAGLTGTKMARR +DEFEF+AIG+ HN GRLAVEILVSG+VFEE DF+RPWEGQ+D Sbjct: 384 AAGAGLTGTKMARRVGSVDEFEFRAIGDNHNQGRLAVEILVSGFVFEEDDFVRPWEGQND 443 Query: 35 NMEK 24 N+E+ Sbjct: 444 NLER 447