BLASTX nr result
ID: Atractylodes22_contig00009151
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00009151 (363 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ADJ67434.1| ethylene response factor 5 [Actinidia deliciosa] 60 1e-07 >gb|ADJ67434.1| ethylene response factor 5 [Actinidia deliciosa] Length = 382 Score = 60.5 bits (145), Expect = 1e-07 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = +3 Query: 237 MCGGAILSDIIAPTANRSRRLTANLLWNTDLINNHSNYFSKP 362 MCGGAI+SD IAPT R+RRL NLLW +D+ NHSNY SKP Sbjct: 1 MCGGAIISDFIAPT--RNRRLIENLLWPSDVKKNHSNYHSKP 40