BLASTX nr result
ID: Atractylodes22_contig00008909
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00008909 (372 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002313839.1| predicted protein [Populus trichocarpa] gi|2... 60 2e-07 ref|XP_002521862.1| conserved hypothetical protein [Ricinus comm... 57 1e-06 >ref|XP_002313839.1| predicted protein [Populus trichocarpa] gi|222850247|gb|EEE87794.1| predicted protein [Populus trichocarpa] Length = 375 Score = 60.1 bits (144), Expect = 2e-07 Identities = 28/44 (63%), Positives = 36/44 (81%) Frame = -2 Query: 371 TANRAVAEEMRRKTTLPHKSGLMGCLRFHQNAGSIHEFSRGINS 240 T NRAV+EEM+RKT LP+K GL+GCL F++ A S+HE SRG+ S Sbjct: 329 TVNRAVSEEMKRKTFLPYKQGLLGCLGFNR-AASVHEISRGVRS 371 >ref|XP_002521862.1| conserved hypothetical protein [Ricinus communis] gi|223538900|gb|EEF40498.1| conserved hypothetical protein [Ricinus communis] Length = 382 Score = 57.4 bits (137), Expect = 1e-06 Identities = 28/44 (63%), Positives = 34/44 (77%) Frame = -2 Query: 371 TANRAVAEEMRRKTTLPHKSGLMGCLRFHQNAGSIHEFSRGINS 240 TANRAV+EEM+RKT LP+K GL+GCL F+ +HE SRGI S Sbjct: 338 TANRAVSEEMKRKTFLPYKQGLLGCLGFNP---GVHEISRGIGS 378