BLASTX nr result
ID: Atractylodes22_contig00008818
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00008818 (688 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_001236683.1| uncharacterized protein LOC100305532 [Glycin... 76 9e-20 gb|ADW66146.1| RING-H2 zinc finger protein [Solanum nigrum] 75 1e-19 ref|NP_001240255.1| uncharacterized protein LOC100786803 [Glycin... 75 3e-19 ref|XP_002533895.1| RING-H2 finger protein ATL3J, putative [Rici... 70 7e-19 ref|NP_178507.1| RING/U-box domain-containing protein [Arabidops... 72 5e-18 >ref|NP_001236683.1| uncharacterized protein LOC100305532 [Glycine max] gi|255625823|gb|ACU13256.1| unknown [Glycine max] Length = 154 Score = 76.3 bits (186), Expect(2) = 9e-20 Identities = 32/51 (62%), Positives = 44/51 (86%), Gaps = 2/51 (3%) Frame = -3 Query: 686 YMEEFRSRTPSQLYDSLC--RRTKQECSVCLVEFKPDAEINRLSCGHVFHK 540 Y+EEFRSRTP+ +DS+C +R + +CSVCL +F+P++EINRLSCGH+FHK Sbjct: 73 YIEEFRSRTPTLRFDSVCCSKRLEHDCSVCLTQFEPESEINRLSCGHLFHK 123 Score = 46.6 bits (109), Expect(2) = 9e-20 Identities = 17/21 (80%), Positives = 18/21 (85%) Frame = -2 Query: 483 CLEKWLKYWNITCPLCRNHMM 421 CLEKWL YWNITCPLCR +M Sbjct: 125 CLEKWLDYWNITCPLCRTPLM 145 >gb|ADW66146.1| RING-H2 zinc finger protein [Solanum nigrum] Length = 144 Score = 75.5 bits (184), Expect(2) = 1e-19 Identities = 36/51 (70%), Positives = 38/51 (74%), Gaps = 2/51 (3%) Frame = -3 Query: 686 YMEEFRSRTPSQLYDSLC--RRTKQECSVCLVEFKPDAEINRLSCGHVFHK 540 YMEEFRSRTP+ YDSLC QEC VCL +F DAEIN LSCGHVFHK Sbjct: 69 YMEEFRSRTPAVRYDSLCISNLPTQECPVCLADFNHDAEINHLSCGHVFHK 119 Score = 47.0 bits (110), Expect(2) = 1e-19 Identities = 18/25 (72%), Positives = 23/25 (92%) Frame = -2 Query: 483 CLEKWLKYWNITCPLCRNHMMMPKE 409 CLEKWLK WN+TCPLCR++ +MP+E Sbjct: 121 CLEKWLKNWNVTCPLCRDY-IMPQE 144 >ref|NP_001240255.1| uncharacterized protein LOC100786803 [Glycine max] gi|255639664|gb|ACU20126.1| unknown [Glycine max] Length = 155 Score = 74.7 bits (182), Expect(2) = 3e-19 Identities = 31/51 (60%), Positives = 44/51 (86%), Gaps = 2/51 (3%) Frame = -3 Query: 686 YMEEFRSRTPSQLYDSLC--RRTKQECSVCLVEFKPDAEINRLSCGHVFHK 540 Y+EEFRSRTP+ +DS+C ++ + +CSVCL +F+P++EINRLSCGH+FHK Sbjct: 74 YIEEFRSRTPTLRFDSVCCCKQPEHDCSVCLTQFEPESEINRLSCGHLFHK 124 Score = 46.6 bits (109), Expect(2) = 3e-19 Identities = 17/21 (80%), Positives = 18/21 (85%) Frame = -2 Query: 483 CLEKWLKYWNITCPLCRNHMM 421 CLEKWL YWNITCPLCR +M Sbjct: 126 CLEKWLDYWNITCPLCRTPLM 146 >ref|XP_002533895.1| RING-H2 finger protein ATL3J, putative [Ricinus communis] gi|223526146|gb|EEF28485.1| RING-H2 finger protein ATL3J, putative [Ricinus communis] Length = 156 Score = 70.5 bits (171), Expect(2) = 7e-19 Identities = 30/51 (58%), Positives = 41/51 (80%), Gaps = 2/51 (3%) Frame = -3 Query: 686 YMEEFRSRTPSQLYDSLCR--RTKQECSVCLVEFKPDAEINRLSCGHVFHK 540 Y+ EFRSRTP+ +DS+CR + + +CSVCL F+P++EIN LSCGH+FHK Sbjct: 73 YINEFRSRTPATRFDSVCRCKQIEHDCSVCLTRFEPESEINCLSCGHLFHK 123 Score = 49.3 bits (116), Expect(2) = 7e-19 Identities = 20/37 (54%), Positives = 27/37 (72%) Frame = -2 Query: 483 CLEKWLKYWNITCPLCRNHMMMPKEVEENTCPM*GFW 373 CLEKWL YWN+TCPLCR+ ++P E + ++C FW Sbjct: 125 CLEKWLDYWNVTCPLCRS-PVIPSEEDTSSC----FW 156 >ref|NP_178507.1| RING/U-box domain-containing protein [Arabidopsis thaliana] gi|42570685|ref|NP_973416.1| RING/U-box domain-containing protein [Arabidopsis thaliana] gi|11692878|gb|AAG40042.1|AF324691_1 T23O15.13 [Arabidopsis thaliana] gi|11908040|gb|AAG41449.1|AF326867_1 putative RING zinc finger protein [Arabidopsis thaliana] gi|12642858|gb|AAK00371.1|AF339689_1 putative RING zinc finger protein [Arabidopsis thaliana] gi|4689478|gb|AAD27914.1| putative RING zinc finger protein [Arabidopsis thaliana] gi|330250717|gb|AEC05811.1| RING/U-box domain-containing protein [Arabidopsis thaliana] gi|330250718|gb|AEC05812.1| RING/U-box domain-containing protein [Arabidopsis thaliana] Length = 162 Score = 71.6 bits (174), Expect(2) = 5e-18 Identities = 32/52 (61%), Positives = 42/52 (80%), Gaps = 3/52 (5%) Frame = -3 Query: 686 YMEEFRSRTPSQLYDSLCRRTKQ---ECSVCLVEFKPDAEINRLSCGHVFHK 540 Y+EEFR+RTP+ ++SLCR KQ ECSVCL +F+ D+EIN+L CGH+FHK Sbjct: 76 YLEEFRNRTPTLRFESLCRCKKQADNECSVCLSKFQGDSEINKLKCGHLFHK 127 Score = 45.4 bits (106), Expect(2) = 5e-18 Identities = 16/25 (64%), Positives = 20/25 (80%) Frame = -2 Query: 483 CLEKWLKYWNITCPLCRNHMMMPKE 409 CLEKW+ YWNITCPLCR +++ E Sbjct: 129 CLEKWIDYWNITCPLCRTPLVVVPE 153