BLASTX nr result
ID: Atractylodes22_contig00008779
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00008779 (281 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAH59409.1| hypothetical protein [Plantago major] 61 8e-08 ref|XP_004165590.1| PREDICTED: translation machinery-associated ... 60 1e-07 ref|NP_563969.1| translation machinery associated protein TMA7 [... 59 3e-07 ref|XP_004133991.1| PREDICTED: translation machinery-associated ... 57 1e-06 gb|ACS96448.1| unknown protein [Jatropha curcas] gi|300078541|gb... 57 1e-06 >emb|CAH59409.1| hypothetical protein [Plantago major] Length = 63 Score = 61.2 bits (147), Expect = 8e-08 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = +3 Query: 66 MSSKQGGKAKPLKQPKADKKEYDEIDKANI 155 MSSKQGGKAKPLKQPK++KKEYDEIDKANI Sbjct: 1 MSSKQGGKAKPLKQPKSEKKEYDEIDKANI 30 >ref|XP_004165590.1| PREDICTED: translation machinery-associated protein 7-like [Cucumis sativus] Length = 109 Score = 60.5 bits (145), Expect = 1e-07 Identities = 27/33 (81%), Positives = 30/33 (90%) Frame = +3 Query: 57 ISTMSSKQGGKAKPLKQPKADKKEYDEIDKANI 155 IS MSSKQGGKAKPLKQPK DKK+YDE+D AN+ Sbjct: 43 ISAMSSKQGGKAKPLKQPKVDKKDYDEVDMANM 75 >ref|NP_563969.1| translation machinery associated protein TMA7 [Arabidopsis thaliana] gi|297849952|ref|XP_002892857.1| hypothetical protein ARALYDRAFT_471721 [Arabidopsis lyrata subsp. lyrata] gi|5103825|gb|AAD39655.1|AC007591_20 ESTs gb|AA650895, gb|AA720043 and gb|R29777 come from this gene [Arabidopsis thaliana] gi|12484215|gb|AAG54006.1|AF336925_1 unknown protein [Arabidopsis thaliana] gi|15028107|gb|AAK76677.1| unknown protein [Arabidopsis thaliana] gi|17065256|gb|AAL32782.1| Unknown protein [Arabidopsis thaliana] gi|20260078|gb|AAM13386.1| unknown protein [Arabidopsis thaliana] gi|21592316|gb|AAM64267.1| unknown [Arabidopsis thaliana] gi|297338699|gb|EFH69116.1| hypothetical protein ARALYDRAFT_471721 [Arabidopsis lyrata subsp. lyrata] gi|332191176|gb|AEE29297.1| translation machinery associated protein TMA7 [Arabidopsis thaliana] Length = 64 Score = 59.3 bits (142), Expect = 3e-07 Identities = 28/30 (93%), Positives = 28/30 (93%) Frame = +3 Query: 66 MSSKQGGKAKPLKQPKADKKEYDEIDKANI 155 MSSKQGGKAKPLKQPKADKKEYDE D ANI Sbjct: 1 MSSKQGGKAKPLKQPKADKKEYDETDLANI 30 >ref|XP_004133991.1| PREDICTED: translation machinery-associated protein 7-like isoform 1 [Cucumis sativus] gi|449432410|ref|XP_004133992.1| PREDICTED: translation machinery-associated protein 7-like isoform 2 [Cucumis sativus] Length = 64 Score = 57.4 bits (137), Expect = 1e-06 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = +3 Query: 66 MSSKQGGKAKPLKQPKADKKEYDEIDKANI 155 MSSKQGGKAKPLKQPK DKK+YDE+D AN+ Sbjct: 1 MSSKQGGKAKPLKQPKVDKKDYDEVDMANM 30 >gb|ACS96448.1| unknown protein [Jatropha curcas] gi|300078541|gb|ADJ67178.1| hypothetical protein [Jatropha curcas] gi|300078545|gb|ADJ67180.1| F9L1.21 protein [Jatropha curcas] Length = 64 Score = 57.4 bits (137), Expect = 1e-06 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = +3 Query: 66 MSSKQGGKAKPLKQPKADKKEYDEIDKANI 155 MSSKQGGKAKPLKQPK+DKKEYDE D ANI Sbjct: 1 MSSKQGGKAKPLKQPKSDKKEYDENDLANI 30