BLASTX nr result
ID: Atractylodes22_contig00008413
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00008413 (208 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAC57958.1| serine/threonine protein kinase [Aster tripolium] 67 2e-09 gb|AAU89742.1| serine/threonine protein kinase-like [Solanum tub... 60 2e-07 >dbj|BAC57958.1| serine/threonine protein kinase [Aster tripolium] Length = 439 Score = 66.6 bits (161), Expect = 2e-09 Identities = 29/36 (80%), Positives = 32/36 (88%) Frame = -3 Query: 206 SFSRNGQPHPRTLSIPHASPHHHRFLQDSPKPNGKQ 99 SFSRNG HPRTLSIP+ASP H++FLQDSP PNGKQ Sbjct: 404 SFSRNGSQHPRTLSIPNASPRHNQFLQDSPNPNGKQ 439 >gb|AAU89742.1| serine/threonine protein kinase-like [Solanum tuberosum] Length = 603 Score = 60.1 bits (144), Expect = 2e-07 Identities = 28/38 (73%), Positives = 32/38 (84%), Gaps = 3/38 (7%) Frame = -3 Query: 206 SFSRNGQPHPRTLSIP---HASPHHHRFLQDSPKPNGK 102 SFSRNGQ HPR+LSIP HASP+H +F Q+SPKPNGK Sbjct: 565 SFSRNGQQHPRSLSIPNGSHASPYHQQFPQNSPKPNGK 602