BLASTX nr result
ID: Atractylodes22_contig00008395
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00008395 (254 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002280915.2| PREDICTED: L-arabinokinase-like [Vitis vinif... 57 2e-15 emb|CBI20799.3| unnamed protein product [Vitis vinifera] 57 2e-15 ref|XP_002527993.1| galactokinase, putative [Ricinus communis] g... 53 2e-14 gb|ABK96635.1| unknown [Populus trichocarpa x Populus deltoides] 53 2e-14 ref|XP_004137182.1| PREDICTED: L-arabinokinase-like [Cucumis sat... 54 2e-13 >ref|XP_002280915.2| PREDICTED: L-arabinokinase-like [Vitis vinifera] Length = 1149 Score = 56.6 bits (135), Expect(2) = 2e-15 Identities = 27/28 (96%), Positives = 28/28 (100%) Frame = -2 Query: 85 YSETAVAPRASILATEVEWLNSIKADLV 2 YSETAVAPRASILATE+EWLNSIKADLV Sbjct: 243 YSETAVAPRASILATEIEWLNSIKADLV 270 Score = 50.4 bits (119), Expect(2) = 2e-15 Identities = 24/42 (57%), Positives = 30/42 (71%) Frame = -1 Query: 254 APDFVFTTEIQSPRLFLRKLVLDCGXXXXXXXXXXXXASLER 129 APDFVFT+E+QSPRLF+RK++LDCG ASLE+ Sbjct: 201 APDFVFTSEVQSPRLFIRKVLLDCGAVQADALTVDRLASLEK 242 >emb|CBI20799.3| unnamed protein product [Vitis vinifera] Length = 1002 Score = 56.6 bits (135), Expect(2) = 2e-15 Identities = 27/28 (96%), Positives = 28/28 (100%) Frame = -2 Query: 85 YSETAVAPRASILATEVEWLNSIKADLV 2 YSETAVAPRASILATE+EWLNSIKADLV Sbjct: 96 YSETAVAPRASILATEIEWLNSIKADLV 123 Score = 50.4 bits (119), Expect(2) = 2e-15 Identities = 24/42 (57%), Positives = 30/42 (71%) Frame = -1 Query: 254 APDFVFTTEIQSPRLFLRKLVLDCGXXXXXXXXXXXXASLER 129 APDFVFT+E+QSPRLF+RK++LDCG ASLE+ Sbjct: 54 APDFVFTSEVQSPRLFIRKVLLDCGAVQADALTVDRLASLEK 95 >ref|XP_002527993.1| galactokinase, putative [Ricinus communis] gi|223532619|gb|EEF34405.1| galactokinase, putative [Ricinus communis] Length = 978 Score = 52.8 bits (125), Expect(2) = 2e-14 Identities = 25/28 (89%), Positives = 26/28 (92%) Frame = -2 Query: 85 YSETAVAPRASILATEVEWLNSIKADLV 2 YSETAV PR SILATE+EWLNSIKADLV Sbjct: 94 YSETAVKPRESILATEIEWLNSIKADLV 121 Score = 50.8 bits (120), Expect(2) = 2e-14 Identities = 25/42 (59%), Positives = 30/42 (71%) Frame = -1 Query: 254 APDFVFTTEIQSPRLFLRKLVLDCGXXXXXXXXXXXXASLER 129 APDFVFT+EIQSPRLF+RK++LDCG ASLE+ Sbjct: 52 APDFVFTSEIQSPRLFIRKVLLDCGAVQADALTVDRLASLEK 93 >gb|ABK96635.1| unknown [Populus trichocarpa x Populus deltoides] Length = 628 Score = 52.8 bits (125), Expect(2) = 2e-14 Identities = 25/28 (89%), Positives = 26/28 (92%) Frame = -2 Query: 85 YSETAVAPRASILATEVEWLNSIKADLV 2 YSETAV PR SILATE+EWLNSIKADLV Sbjct: 95 YSETAVKPRESILATEIEWLNSIKADLV 122 Score = 50.8 bits (120), Expect(2) = 2e-14 Identities = 25/42 (59%), Positives = 30/42 (71%) Frame = -1 Query: 254 APDFVFTTEIQSPRLFLRKLVLDCGXXXXXXXXXXXXASLER 129 APDFVFT+EIQSPRLF+RK++LDCG ASLE+ Sbjct: 53 APDFVFTSEIQSPRLFIRKVLLDCGAVQADALTVDRLASLEK 94 >ref|XP_004137182.1| PREDICTED: L-arabinokinase-like [Cucumis sativus] Length = 996 Score = 53.5 bits (127), Expect(2) = 2e-13 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -2 Query: 85 YSETAVAPRASILATEVEWLNSIKADLV 2 Y ETAV PRASILATEVEWLNSIKADLV Sbjct: 97 YHETAVVPRASILATEVEWLNSIKADLV 124 Score = 47.0 bits (110), Expect(2) = 2e-13 Identities = 23/42 (54%), Positives = 29/42 (69%) Frame = -1 Query: 254 APDFVFTTEIQSPRLFLRKLVLDCGXXXXXXXXXXXXASLER 129 AP+FVFT+ IQSPRLF+RK++LDCG ASLE+ Sbjct: 55 APEFVFTSAIQSPRLFIRKVLLDCGAVQADALTVDRLASLEK 96