BLASTX nr result
ID: Atractylodes22_contig00008153
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00008153 (462 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002524267.1| DAG protein, chloroplast precursor, putative... 104 6e-21 ref|XP_004168263.1| PREDICTED: uncharacterized protein At3g15000... 101 5e-20 ref|XP_004137307.1| PREDICTED: uncharacterized protein At3g15000... 101 5e-20 ref|XP_002882907.1| hypothetical protein ARALYDRAFT_478926 [Arab... 100 1e-19 emb|CBI20208.3| unnamed protein product [Vitis vinifera] 100 2e-19 >ref|XP_002524267.1| DAG protein, chloroplast precursor, putative [Ricinus communis] gi|223536458|gb|EEF38106.1| DAG protein, chloroplast precursor, putative [Ricinus communis] Length = 389 Score = 104 bits (260), Expect = 6e-21 Identities = 50/51 (98%), Positives = 50/51 (98%) Frame = -3 Query: 460 EARMKIYSVSTRCYYAFGALVSEELSYKIKELPGVRWVLPDSYLDVKNKDY 308 EARMKIYSVSTRCYYAFGALVSEELSYKIKELP VRWVLPDSYLDVKNKDY Sbjct: 131 EARMKIYSVSTRCYYAFGALVSEELSYKIKELPRVRWVLPDSYLDVKNKDY 181 >ref|XP_004168263.1| PREDICTED: uncharacterized protein At3g15000, mitochondrial-like, partial [Cucumis sativus] Length = 278 Score = 101 bits (252), Expect = 5e-20 Identities = 48/51 (94%), Positives = 49/51 (96%) Frame = -3 Query: 460 EARMKIYSVSTRCYYAFGALVSEELSYKIKELPGVRWVLPDSYLDVKNKDY 308 EARMKIYSVSTRCY+AFG LVSEELSYKIKELP VRWVLPDSYLDVKNKDY Sbjct: 137 EARMKIYSVSTRCYFAFGCLVSEELSYKIKELPKVRWVLPDSYLDVKNKDY 187 >ref|XP_004137307.1| PREDICTED: uncharacterized protein At3g15000, mitochondrial-like [Cucumis sativus] Length = 410 Score = 101 bits (252), Expect = 5e-20 Identities = 48/51 (94%), Positives = 49/51 (96%) Frame = -3 Query: 460 EARMKIYSVSTRCYYAFGALVSEELSYKIKELPGVRWVLPDSYLDVKNKDY 308 EARMKIYSVSTRCY+AFG LVSEELSYKIKELP VRWVLPDSYLDVKNKDY Sbjct: 137 EARMKIYSVSTRCYFAFGCLVSEELSYKIKELPKVRWVLPDSYLDVKNKDY 187 >ref|XP_002882907.1| hypothetical protein ARALYDRAFT_478926 [Arabidopsis lyrata subsp. lyrata] gi|297328747|gb|EFH59166.1| hypothetical protein ARALYDRAFT_478926 [Arabidopsis lyrata subsp. lyrata] Length = 396 Score = 100 bits (249), Expect = 1e-19 Identities = 46/51 (90%), Positives = 50/51 (98%) Frame = -3 Query: 460 EARMKIYSVSTRCYYAFGALVSEELSYKIKELPGVRWVLPDSYLDVKNKDY 308 EARMKIYSVSTRCYYAFGALVSE+LS+K+KELP VRWVLPDSYLDV+NKDY Sbjct: 133 EARMKIYSVSTRCYYAFGALVSEDLSHKLKELPNVRWVLPDSYLDVRNKDY 183 >emb|CBI20208.3| unnamed protein product [Vitis vinifera] Length = 229 Score = 100 bits (248), Expect = 2e-19 Identities = 48/51 (94%), Positives = 49/51 (96%) Frame = -3 Query: 460 EARMKIYSVSTRCYYAFGALVSEELSYKIKELPGVRWVLPDSYLDVKNKDY 308 EARMKIYSVSTRCY+AFGALVSEELS KIKELP VRWVLPDSYLDVKNKDY Sbjct: 30 EARMKIYSVSTRCYFAFGALVSEELSLKIKELPRVRWVLPDSYLDVKNKDY 80