BLASTX nr result
ID: Atractylodes22_contig00007962
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00007962 (327 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABG22120.1| polyprotein [Cynara cardunculus var. scolymus] 64 1e-08 emb|CAN83181.1| hypothetical protein VITISV_013310 [Vitis vinifera] 60 2e-07 emb|CAN68742.1| hypothetical protein VITISV_036839 [Vitis vinifera] 60 2e-07 emb|CAN74666.1| hypothetical protein VITISV_005684 [Vitis vinifera] 60 2e-07 emb|CAN68289.1| hypothetical protein VITISV_019714 [Vitis vinifera] 59 5e-07 >gb|ABG22120.1| polyprotein [Cynara cardunculus var. scolymus] Length = 349 Score = 63.9 bits (154), Expect = 1e-08 Identities = 28/38 (73%), Positives = 33/38 (86%), Gaps = 2/38 (5%) Frame = +2 Query: 71 CLCAR--SHPKESHMATVKRIFRYLKGLPELGVWYPKN 178 CLCAR ++PKESH+A VKRIFRYLKG P LG+WYPK+ Sbjct: 203 CLCARYQANPKESHLAAVKRIFRYLKGTPNLGLWYPKD 240 >emb|CAN83181.1| hypothetical protein VITISV_013310 [Vitis vinifera] Length = 455 Score = 59.7 bits (143), Expect = 2e-07 Identities = 28/44 (63%), Positives = 35/44 (79%), Gaps = 4/44 (9%) Frame = +2 Query: 71 CLCAR--SHPKESHMATVKRIFRYLKGLPELGVWYPK--NFSLV 190 CLCAR S PKESH++ VKRI RYLKG+ ++G+WYPK NF L+ Sbjct: 260 CLCARFQSCPKESHLSAVKRILRYLKGIMDIGLWYPKGDNFELI 303 >emb|CAN68742.1| hypothetical protein VITISV_036839 [Vitis vinifera] Length = 334 Score = 59.7 bits (143), Expect = 2e-07 Identities = 28/44 (63%), Positives = 35/44 (79%), Gaps = 4/44 (9%) Frame = +2 Query: 71 CLCAR--SHPKESHMATVKRIFRYLKGLPELGVWYPK--NFSLV 190 CLCAR S PKESH++ VKRI RYLKG+ ++G+WYPK NF L+ Sbjct: 139 CLCARFQSCPKESHLSVVKRILRYLKGIMDIGLWYPKGDNFELI 182 >emb|CAN74666.1| hypothetical protein VITISV_005684 [Vitis vinifera] Length = 303 Score = 59.7 bits (143), Expect = 2e-07 Identities = 28/44 (63%), Positives = 35/44 (79%), Gaps = 4/44 (9%) Frame = +2 Query: 71 CLCAR--SHPKESHMATVKRIFRYLKGLPELGVWYPK--NFSLV 190 CLCAR S PKESH++ VKRI RYLKG+ ++G+WYPK NF L+ Sbjct: 139 CLCARFQSCPKESHLSVVKRILRYLKGIMDIGLWYPKGDNFELI 182 >emb|CAN68289.1| hypothetical protein VITISV_019714 [Vitis vinifera] Length = 216 Score = 58.5 bits (140), Expect = 5e-07 Identities = 28/44 (63%), Positives = 34/44 (77%), Gaps = 4/44 (9%) Frame = +2 Query: 71 CLCAR--SHPKESHMATVKRIFRYLKGLPELGVWYPK--NFSLV 190 CLCAR S PKESH++ VKRI RYLKG ++G+WYPK NF L+ Sbjct: 89 CLCARFQSCPKESHLSVVKRILRYLKGTMDIGLWYPKGDNFELI 132