BLASTX nr result
ID: Atractylodes22_contig00007952
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00007952 (277 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002316257.1| folylpolyglutamate synthase [Populus trichoc... 65 7e-09 ref|XP_002873232.1| hypothetical protein ARALYDRAFT_487401 [Arab... 62 6e-08 ref|XP_003544172.1| PREDICTED: folylpolyglutamate synthase, mito... 60 1e-07 ref|XP_003519364.1| PREDICTED: folylpolyglutamate synthase, mito... 59 4e-07 ref|XP_002524236.1| folylpolyglutamate synthase, putative [Ricin... 59 4e-07 >ref|XP_002316257.1| folylpolyglutamate synthase [Populus trichocarpa] gi|222865297|gb|EEF02428.1| folylpolyglutamate synthase [Populus trichocarpa] Length = 587 Score = 64.7 bits (156), Expect = 7e-09 Identities = 31/49 (63%), Positives = 40/49 (81%) Frame = +1 Query: 127 SDQNMAQPYDEAMDALSSLITKKNRADKMAVDHRFELMFDYVKILDLEE 273 S + A PY+EA+DALSSLITK++RADK RF+L+FDY+KIL+LEE Sbjct: 9 SSKPTATPYEEALDALSSLITKRSRADKSNKGDRFDLLFDYLKILELEE 57 >ref|XP_002873232.1| hypothetical protein ARALYDRAFT_487401 [Arabidopsis lyrata subsp. lyrata] gi|297319069|gb|EFH49491.1| hypothetical protein ARALYDRAFT_487401 [Arabidopsis lyrata subsp. lyrata] Length = 570 Score = 61.6 bits (148), Expect = 6e-08 Identities = 34/70 (48%), Positives = 47/70 (67%), Gaps = 4/70 (5%) Frame = +1 Query: 76 HEDTHILTLTNCSISCQSDQNMA----QPYDEAMDALSSLITKKNRADKMAVDHRFELMF 243 H+ H+ +L+ S + +MA Y+EA+ ALSSLITK++RADK RFEL+F Sbjct: 37 HQQPHLTSLSFQIRSLRKQIDMAAQGGDSYEEALAALSSLITKRSRADKSNKGDRFELVF 96 Query: 244 DYVKILDLEE 273 DY+K+LDLEE Sbjct: 97 DYLKLLDLEE 106 >ref|XP_003544172.1| PREDICTED: folylpolyglutamate synthase, mitochondrial-like [Glycine max] Length = 548 Score = 60.5 bits (145), Expect = 1e-07 Identities = 27/43 (62%), Positives = 36/43 (83%) Frame = +1 Query: 148 PYDEAMDALSSLITKKNRADKMAVDHRFELMFDYVKILDLEEP 276 PY+EAM+ALSSLIT++ RAD V +F L++DY+K+LDLEEP Sbjct: 18 PYEEAMEALSSLITRRTRADDSNVGDQFSLLYDYLKMLDLEEP 60 >ref|XP_003519364.1| PREDICTED: folylpolyglutamate synthase, mitochondrial-like [Glycine max] Length = 542 Score = 58.9 bits (141), Expect = 4e-07 Identities = 26/43 (60%), Positives = 36/43 (83%) Frame = +1 Query: 148 PYDEAMDALSSLITKKNRADKMAVDHRFELMFDYVKILDLEEP 276 PY+EAM+ALSSLIT++ RAD V +F L++DY+K+L+LEEP Sbjct: 18 PYEEAMEALSSLITRRTRADDSNVGDQFSLLYDYLKMLELEEP 60 >ref|XP_002524236.1| folylpolyglutamate synthase, putative [Ricinus communis] gi|223536513|gb|EEF38160.1| folylpolyglutamate synthase, putative [Ricinus communis] Length = 531 Score = 58.9 bits (141), Expect = 4e-07 Identities = 27/41 (65%), Positives = 35/41 (85%) Frame = +1 Query: 151 YDEAMDALSSLITKKNRADKMAVDHRFELMFDYVKILDLEE 273 Y+EAMDALSSLITK++RADK RF+ +FDY+K+LDLE+ Sbjct: 16 YEEAMDALSSLITKRSRADKSNKGDRFDFLFDYLKMLDLEQ 56