BLASTX nr result
ID: Atractylodes22_contig00007704
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00007704 (337 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002276935.1| PREDICTED: pentatricopeptide repeat-containi... 63 2e-08 emb|CBI26127.3| unnamed protein product [Vitis vinifera] 63 2e-08 ref|XP_002879637.1| pentatricopeptide repeat-containing protein ... 62 4e-08 ref|XP_003528655.1| PREDICTED: pentatricopeptide repeat-containi... 60 2e-07 ref|NP_181235.1| pentatricopeptide repeat-containing protein [Ar... 54 1e-05 >ref|XP_002276935.1| PREDICTED: pentatricopeptide repeat-containing protein At2g36980, mitochondrial-like [Vitis vinifera] Length = 623 Score = 63.2 bits (152), Expect = 2e-08 Identities = 29/43 (67%), Positives = 34/43 (79%) Frame = +2 Query: 209 MGSYLVHTTTKIAALAKSGRVTCARKLFDEMSHRDTVVWNTML 337 M S+L TT+KI ALAK GR+T AR+LFDEM H+DTV WN ML Sbjct: 1 MHSHLFQTTSKIVALAKLGRITSARRLFDEMPHKDTVAWNAML 43 >emb|CBI26127.3| unnamed protein product [Vitis vinifera] Length = 603 Score = 63.2 bits (152), Expect = 2e-08 Identities = 29/43 (67%), Positives = 34/43 (79%) Frame = +2 Query: 209 MGSYLVHTTTKIAALAKSGRVTCARKLFDEMSHRDTVVWNTML 337 M S+L TT+KI ALAK GR+T AR+LFDEM H+DTV WN ML Sbjct: 1 MHSHLFQTTSKIVALAKLGRITSARRLFDEMPHKDTVAWNAML 43 >ref|XP_002879637.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297325476|gb|EFH55896.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 624 Score = 62.4 bits (150), Expect = 4e-08 Identities = 29/41 (70%), Positives = 35/41 (85%) Frame = +2 Query: 215 SYLVHTTTKIAALAKSGRVTCARKLFDEMSHRDTVVWNTML 337 S LV T+KIA+LAKSGR+T AR++FDEM+ RDTV WNTML Sbjct: 2 SVLVRLTSKIASLAKSGRITSARQMFDEMTDRDTVAWNTML 42 >ref|XP_003528655.1| PREDICTED: pentatricopeptide repeat-containing protein At2g36980, mitochondrial-like [Glycine max] Length = 629 Score = 59.7 bits (143), Expect = 2e-07 Identities = 27/43 (62%), Positives = 34/43 (79%) Frame = +2 Query: 209 MGSYLVHTTTKIAALAKSGRVTCARKLFDEMSHRDTVVWNTML 337 M SYL TT KI ALA+SG+++ ARKLFDE+ H+D+V WN ML Sbjct: 1 MRSYLFRTTPKIVALARSGQISDARKLFDEIPHKDSVAWNAML 43 >ref|NP_181235.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75206293|sp|Q9SJK9.1|PP189_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At2g36980, mitochondrial; Flags: Precursor gi|4883614|gb|AAD31583.1| hypothetical protein [Arabidopsis thaliana] gi|330254236|gb|AEC09330.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 625 Score = 54.3 bits (129), Expect = 1e-05 Identities = 26/41 (63%), Positives = 31/41 (75%) Frame = +2 Query: 215 SYLVHTTTKIAALAKSGRVTCARKLFDEMSHRDTVVWNTML 337 S LV T+KIA+LAKSGR+ AR++FD M DTV WNTML Sbjct: 2 SVLVRLTSKIASLAKSGRIASARQVFDGMPELDTVAWNTML 42