BLASTX nr result
ID: Atractylodes22_contig00007328
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00007328 (392 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003635480.1| PREDICTED: uncharacterized protein LOC100853... 55 6e-06 >ref|XP_003635480.1| PREDICTED: uncharacterized protein LOC100853147 [Vitis vinifera] gi|296090665|emb|CBI41065.3| unnamed protein product [Vitis vinifera] Length = 68 Score = 55.1 bits (131), Expect = 6e-06 Identities = 21/36 (58%), Positives = 27/36 (75%) Frame = +1 Query: 40 AGDSSIHPQAGCRCCNFVYVKGLITCGRVCCQDGCC 147 A + +HPQAGCRCC F++ K I+CG+ CC DGCC Sbjct: 31 AVEDMVHPQAGCRCCWFIW-KPRISCGKACCGDGCC 65