BLASTX nr result
ID: Atractylodes22_contig00007265
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00007265 (439 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002530454.1| conserved hypothetical protein [Ricinus comm... 75 5e-12 ref|XP_004136095.1| PREDICTED: putative UPF0481 protein At3g0264... 75 7e-12 ref|XP_002313925.1| predicted protein [Populus trichocarpa] gi|2... 74 2e-11 ref|XP_004158823.1| PREDICTED: putative UPF0481 protein At3g0264... 73 3e-11 ref|XP_004136096.1| PREDICTED: uncharacterized protein LOC101205... 73 3e-11 >ref|XP_002530454.1| conserved hypothetical protein [Ricinus communis] gi|223529999|gb|EEF31924.1| conserved hypothetical protein [Ricinus communis] Length = 531 Score = 75.1 bits (183), Expect = 5e-12 Identities = 36/72 (50%), Positives = 46/72 (63%) Frame = -3 Query: 437 PKMDKVIEDVNKSYGKTWRVKLANFMKTYVFGSWKXXXXXXXXXXXXXXXLQAFCSVYSC 258 P +DKVIEDVNK Y W+V++ +FMK+YVFGSW+ LQAFCSVYSC Sbjct: 460 PFLDKVIEDVNKYYNGRWKVRVGSFMKSYVFGSWQFLTLLAAVFLLMLTALQAFCSVYSC 519 Query: 257 ARVFHQLPDIQG 222 +R+F+ D G Sbjct: 520 SRLFNISTDESG 531 >ref|XP_004136095.1| PREDICTED: putative UPF0481 protein At3g02645-like [Cucumis sativus] gi|449491181|ref|XP_004158822.1| PREDICTED: putative UPF0481 protein At3g02645-like [Cucumis sativus] Length = 573 Score = 74.7 bits (182), Expect = 7e-12 Identities = 36/67 (53%), Positives = 41/67 (61%) Frame = -3 Query: 437 PKMDKVIEDVNKSYGKTWRVKLANFMKTYVFGSWKXXXXXXXXXXXXXXXLQAFCSVYSC 258 P +DKVIEDVNK Y W+VK + F+K YVFGSW LQAFCSVYSC Sbjct: 502 PFLDKVIEDVNKYYSGRWKVKASKFVKKYVFGSWPLLAFLATILLLAMTALQAFCSVYSC 561 Query: 257 ARVFHQL 237 +R FH L Sbjct: 562 SRFFHHL 568 >ref|XP_002313925.1| predicted protein [Populus trichocarpa] gi|222850333|gb|EEE87880.1| predicted protein [Populus trichocarpa] Length = 559 Score = 73.6 bits (179), Expect = 2e-11 Identities = 35/65 (53%), Positives = 40/65 (61%) Frame = -3 Query: 437 PKMDKVIEDVNKSYGKTWRVKLANFMKTYVFGSWKXXXXXXXXXXXXXXXLQAFCSVYSC 258 P +DKVIEDVNK Y + W VK+ FMK YVFGSW+ LQAFCSVY C Sbjct: 490 PFLDKVIEDVNKYYNQRWTVKVGKFMKRYVFGSWQFLTLLAAVFLLLLMTLQAFCSVYRC 549 Query: 257 ARVFH 243 +RV H Sbjct: 550 SRVLH 554 >ref|XP_004158823.1| PREDICTED: putative UPF0481 protein At3g02645-like [Cucumis sativus] Length = 560 Score = 72.8 bits (177), Expect = 3e-11 Identities = 35/67 (52%), Positives = 41/67 (61%) Frame = -3 Query: 437 PKMDKVIEDVNKSYGKTWRVKLANFMKTYVFGSWKXXXXXXXXXXXXXXXLQAFCSVYSC 258 P +DKVIEDVNK Y W+VK A F++ YVFGSW LQAFCSVYSC Sbjct: 489 PFLDKVIEDVNKHYSNRWKVKAAKFVEKYVFGSWPLLALLATILLLAMNALQAFCSVYSC 548 Query: 257 ARVFHQL 237 +R F+ L Sbjct: 549 SRFFNHL 555 >ref|XP_004136096.1| PREDICTED: uncharacterized protein LOC101205322 [Cucumis sativus] Length = 1559 Score = 72.8 bits (177), Expect = 3e-11 Identities = 35/67 (52%), Positives = 41/67 (61%) Frame = -3 Query: 437 PKMDKVIEDVNKSYGKTWRVKLANFMKTYVFGSWKXXXXXXXXXXXXXXXLQAFCSVYSC 258 P +DKVIEDVNK Y W+VK A F++ YVFGSW LQAFCSVYSC Sbjct: 1488 PFLDKVIEDVNKHYSNRWKVKAAKFVEKYVFGSWPLLALLATILLLAMNALQAFCSVYSC 1547 Query: 257 ARVFHQL 237 +R F+ L Sbjct: 1548 SRFFNHL 1554