BLASTX nr result
ID: Atractylodes22_contig00007203
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00007203 (311 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AEZ35251.1| cyclin-dependent kinase inhibitor [Persea americana] 55 8e-06 ref|NP_001152456.1| cyclin dependent kinase inhibitor [Zea mays]... 54 1e-05 ref|XP_003632370.1| PREDICTED: cyclin-dependent kinase inhibitor... 54 1e-05 >gb|AEZ35251.1| cyclin-dependent kinase inhibitor [Persea americana] Length = 218 Score = 54.7 bits (130), Expect = 8e-06 Identities = 45/101 (44%), Positives = 57/101 (56%), Gaps = 13/101 (12%) Frame = +2 Query: 2 KTTGEVSLMEVPSLG-GVLTRAKTLALQK------AAAVSYIQLRSRRLVKPTS----PK 148 K T EV +MEV GV TRA+ LALQ A + SY+QLRSRRL KP + K Sbjct: 9 KITSEVVVMEVSQASLGVRTRARALALQNLQNTSSATSSSYLQLRSRRLEKPVAAEEEAK 68 Query: 149 KPKENC--AVTNPSKLRGVNSSRMTVNSVDSVKELDDKEEE 265 KPKE C ++ S+L V+ + +V SV SV + EEE Sbjct: 69 KPKEGCKQKCSSNSRLGSVSVNSGSVGSV-SVSFSTNGEEE 108 >ref|NP_001152456.1| cyclin dependent kinase inhibitor [Zea mays] gi|195656489|gb|ACG47712.1| cyclin dependent kinase inhibitor [Zea mays] Length = 131 Score = 54.3 bits (129), Expect = 1e-05 Identities = 39/102 (38%), Positives = 53/102 (51%), Gaps = 13/102 (12%) Frame = +2 Query: 2 KTTGEVSLMEVP--SLGGVLTRAKTLALQKA-----------AAVSYIQLRSRRLVKPTS 142 K +GEV++MEVP +L GV TR++TLALQ+A AA Y++LRSRRL KP Sbjct: 9 KVSGEVAVMEVPGGALLGVRTRSRTLALQRAQRPLDKGDAEDAAAEYLELRSRRLEKP-H 67 Query: 143 PKKPKENCAVTNPSKLRGVNSSRMTVNSVDSVKELDDKEEES 268 + P P+ RG +V V D+ E E+ Sbjct: 68 KEHPPPPAPAPAPATKRGAGRKAAAAAAVQHVLMQDEDEVEA 109 >ref|XP_003632370.1| PREDICTED: cyclin-dependent kinase inhibitor 3-like [Vitis vinifera] gi|297744341|emb|CBI37311.3| unnamed protein product [Vitis vinifera] Length = 218 Score = 54.3 bits (129), Expect = 1e-05 Identities = 46/115 (40%), Positives = 62/115 (53%), Gaps = 12/115 (10%) Frame = +2 Query: 2 KTTGEVSLMEVPSLGGVLTRAKTLALQKAAA----------VSYIQLRSRRLVKPTSPKK 151 K TG+V++MEV S GV TRAKTLALQ+ SY++LRSRRL KP + Sbjct: 9 KITGDVTVMEVSSSLGVRTRAKTLALQRLQKTTHQEGPKPDTSYLELRSRRLEKPPLLSE 68 Query: 152 PKENCAVTNPSKLRGVNSSRMTVNSV--DSVKELDDKEEESRQETEIKGAGDVGI 310 P + NP+ SSR+ + SV +SV + E+ + ETE DVG+ Sbjct: 69 PNKK---QNPNPKA---SSRVELGSVNSNSVGSVPPGEKINAVETE-----DVGV 112