BLASTX nr result
ID: Atractylodes22_contig00007144
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00007144 (286 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003542736.1| PREDICTED: probable LRR receptor-like serine... 56 3e-06 >ref|XP_003542736.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At1g51860-like [Glycine max] Length = 626 Score = 56.2 bits (134), Expect = 3e-06 Identities = 25/34 (73%), Positives = 29/34 (85%) Frame = -1 Query: 286 KARTHFSRDVQLTRHNNGHEHARTAAENGPILLS 185 KARTHFSRD+Q+TRH+N + TAAENGPILLS Sbjct: 593 KARTHFSRDIQMTRHHNNYGKTSTAAENGPILLS 626