BLASTX nr result
ID: Atractylodes22_contig00006591
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00006591 (1389 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI18070.3| unnamed protein product [Vitis vinifera] 99 3e-18 ref|XP_002267787.1| PREDICTED: alanine--glyoxylate aminotransfer... 99 3e-18 ref|XP_002270785.1| PREDICTED: alanine--glyoxylate aminotransfer... 98 4e-18 emb|CBI15855.3| unnamed protein product [Vitis vinifera] 98 4e-18 dbj|BAJ33985.1| unnamed protein product [Thellungiella halophila] 94 8e-17 >emb|CBI18070.3| unnamed protein product [Vitis vinifera] Length = 436 Score = 98.6 bits (244), Expect = 3e-18 Identities = 41/58 (70%), Positives = 51/58 (87%) Frame = +3 Query: 228 MPPFDYTPPPYGGPSAAEILEKRRRHLSPCMSCFYKNPLYLVDGKMQYLFDESGQRYL 401 MPPFDY+PPPY GPSAA+IL+KR+++LSP + CFY P+ +VDGKMQYLFDE G+RYL Sbjct: 1 MPPFDYSPPPYNGPSAADILQKRKQYLSPSIFCFYNQPVNIVDGKMQYLFDEKGRRYL 58 >ref|XP_002267787.1| PREDICTED: alanine--glyoxylate aminotransferase 2 homolog 2, mitochondrial [Vitis vinifera] Length = 477 Score = 98.6 bits (244), Expect = 3e-18 Identities = 41/58 (70%), Positives = 51/58 (87%) Frame = +3 Query: 228 MPPFDYTPPPYGGPSAAEILEKRRRHLSPCMSCFYKNPLYLVDGKMQYLFDESGQRYL 401 MPPFDY+PPPY GPSAA+IL+KR+++LSP + CFY P+ +VDGKMQYLFDE G+RYL Sbjct: 42 MPPFDYSPPPYNGPSAADILQKRKQYLSPSIFCFYNQPVNIVDGKMQYLFDEKGRRYL 99 >ref|XP_002270785.1| PREDICTED: alanine--glyoxylate aminotransferase 2 homolog 2, mitochondrial-like [Vitis vinifera] Length = 478 Score = 98.2 bits (243), Expect = 4e-18 Identities = 44/58 (75%), Positives = 51/58 (87%) Frame = +3 Query: 228 MPPFDYTPPPYGGPSAAEILEKRRRHLSPCMSCFYKNPLYLVDGKMQYLFDESGQRYL 401 MPPFDY+PPPY GPSAAEIL+KR+ +LSP + FY NPL LVDGKMQYLFDE+G+RYL Sbjct: 43 MPPFDYSPPPYTGPSAAEILKKRQEYLSPSLFHFYSNPLNLVDGKMQYLFDENGRRYL 100 >emb|CBI15855.3| unnamed protein product [Vitis vinifera] Length = 436 Score = 98.2 bits (243), Expect = 4e-18 Identities = 44/58 (75%), Positives = 51/58 (87%) Frame = +3 Query: 228 MPPFDYTPPPYGGPSAAEILEKRRRHLSPCMSCFYKNPLYLVDGKMQYLFDESGQRYL 401 MPPFDY+PPPY GPSAAEIL+KR+ +LSP + FY NPL LVDGKMQYLFDE+G+RYL Sbjct: 1 MPPFDYSPPPYTGPSAAEILKKRQEYLSPSLFHFYSNPLNLVDGKMQYLFDENGRRYL 58 >dbj|BAJ33985.1| unnamed protein product [Thellungiella halophila] Length = 478 Score = 94.0 bits (232), Expect = 8e-17 Identities = 41/58 (70%), Positives = 47/58 (81%) Frame = +3 Query: 228 MPPFDYTPPPYGGPSAAEILEKRRRHLSPCMSCFYKNPLYLVDGKMQYLFDESGQRYL 401 +PPFDYTPPPY GPS+ IL KR+ LSP M C Y+ PL +VDGKMQYLFDESG+RYL Sbjct: 44 LPPFDYTPPPYTGPSSDVILNKRKEFLSPSMPCLYRKPLNIVDGKMQYLFDESGRRYL 101