BLASTX nr result
ID: Atractylodes22_contig00006380
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00006380 (235 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAL73984.1|AF466149_1 type IIB calcium ATPase [Medicago trunc... 59 5e-07 ref|XP_003554165.1| PREDICTED: putative calcium-transporting ATP... 55 6e-06 >gb|AAL73984.1|AF466149_1 type IIB calcium ATPase [Medicago truncatula] Length = 1037 Score = 58.5 bits (140), Expect = 5e-07 Identities = 31/49 (63%), Positives = 38/49 (77%), Gaps = 2/49 (4%) Frame = +1 Query: 94 DIPIRNDFEVLK--LKEKIRIALYVQKAALQFIDAANRTERKLSEEVVQ 234 D+ R++ E +K +KEKIRIALYVQKAALQFIDA NR E KLS E ++ Sbjct: 43 DLEKRSEAEQIKQGIKEKIRIALYVQKAALQFIDAGNRVEYKLSREAIE 91 >ref|XP_003554165.1| PREDICTED: putative calcium-transporting ATPase 11, plasma membrane-type-like [Glycine max] Length = 1035 Score = 55.1 bits (131), Expect = 6e-06 Identities = 31/47 (65%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +1 Query: 94 DIPIRNDFEVLK--LKEKIRIALYVQKAALQFIDAANRTERKLSEEV 228 D+ R + E +K +KEK RIALYVQKAALQFIDA NR E KLS EV Sbjct: 43 DLDKRVEAEQIKQGIKEKFRIALYVQKAALQFIDAGNRVEYKLSSEV 89