BLASTX nr result
ID: Atractylodes22_contig00006261
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00006261 (546 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFP57455.1| RNA-binding glycine-rich protein [Nicotiana undul... 109 3e-22 gb|AFP57453.1| RNA-binding glycine-rich protein [Nicotiana rustica] 109 3e-22 gb|AFP57449.1| RNA-binding glycine-rich protein [Nicotiana glauca] 109 3e-22 gb|AFP57448.1| RNA-binding glycine-rich protein [Nicotiana cleve... 109 3e-22 gb|AFP57452.1| RNA-binding glycine-rich protein [Nicotiana repanda] 108 7e-22 >gb|AFP57455.1| RNA-binding glycine-rich protein [Nicotiana undulata] Length = 144 Score = 109 bits (272), Expect = 3e-22 Identities = 52/68 (76%), Positives = 62/68 (91%) Frame = +3 Query: 3 LKEAFSCFGDVVDARVIMDRETGRSRGFGFVNYSSDESANEAMTAMDGQELNGRTIRVSL 182 L++AF+ FGDVVDARVI+DR++GRSRGFGFVN+S DESANEA+ AMDGQEL GR IRVS+ Sbjct: 54 LRDAFATFGDVVDARVIVDRDSGRSRGFGFVNFSDDESANEAIKAMDGQELQGRNIRVSI 113 Query: 183 ATERAPRT 206 A ERAPR+ Sbjct: 114 AQERAPRS 121 >gb|AFP57453.1| RNA-binding glycine-rich protein [Nicotiana rustica] Length = 144 Score = 109 bits (272), Expect = 3e-22 Identities = 52/68 (76%), Positives = 62/68 (91%) Frame = +3 Query: 3 LKEAFSCFGDVVDARVIMDRETGRSRGFGFVNYSSDESANEAMTAMDGQELNGRTIRVSL 182 L++AF+ FGDVVDARVI+DR++GRSRGFGFVN+S DESANEA+ AMDGQEL GR IRVS+ Sbjct: 54 LRDAFATFGDVVDARVIVDRDSGRSRGFGFVNFSDDESANEAIKAMDGQELQGRNIRVSI 113 Query: 183 ATERAPRT 206 A ERAPR+ Sbjct: 114 AQERAPRS 121 >gb|AFP57449.1| RNA-binding glycine-rich protein [Nicotiana glauca] Length = 144 Score = 109 bits (272), Expect = 3e-22 Identities = 52/68 (76%), Positives = 62/68 (91%) Frame = +3 Query: 3 LKEAFSCFGDVVDARVIMDRETGRSRGFGFVNYSSDESANEAMTAMDGQELNGRTIRVSL 182 L++AF+ FGDVVDARVI+DR++GRSRGFGFVN+S DESANEA+ AMDGQEL GR IRVS+ Sbjct: 54 LRDAFATFGDVVDARVIVDRDSGRSRGFGFVNFSDDESANEAIKAMDGQELQGRNIRVSI 113 Query: 183 ATERAPRT 206 A ERAPR+ Sbjct: 114 AQERAPRS 121 >gb|AFP57448.1| RNA-binding glycine-rich protein [Nicotiana clevelandii] Length = 144 Score = 109 bits (272), Expect = 3e-22 Identities = 52/68 (76%), Positives = 62/68 (91%) Frame = +3 Query: 3 LKEAFSCFGDVVDARVIMDRETGRSRGFGFVNYSSDESANEAMTAMDGQELNGRTIRVSL 182 L++AF+ FGDVVDARVI+DR++GRSRGFGFVN+S DESANEA+ AMDGQEL GR IRVS+ Sbjct: 54 LRDAFATFGDVVDARVIVDRDSGRSRGFGFVNFSDDESANEAIKAMDGQELQGRNIRVSI 113 Query: 183 ATERAPRT 206 A ERAPR+ Sbjct: 114 AQERAPRS 121 >gb|AFP57452.1| RNA-binding glycine-rich protein [Nicotiana repanda] Length = 144 Score = 108 bits (269), Expect = 7e-22 Identities = 51/68 (75%), Positives = 62/68 (91%) Frame = +3 Query: 3 LKEAFSCFGDVVDARVIMDRETGRSRGFGFVNYSSDESANEAMTAMDGQELNGRTIRVSL 182 L++AF+ FGDVVDARVI+DR++GRSRGFGFVN+S DESANEA+ AMDGQEL GR IRV++ Sbjct: 54 LRDAFATFGDVVDARVIVDRDSGRSRGFGFVNFSDDESANEAIKAMDGQELQGRNIRVTI 113 Query: 183 ATERAPRT 206 A ERAPR+ Sbjct: 114 AQERAPRS 121