BLASTX nr result
ID: Atractylodes22_contig00006241
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00006241 (238 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AEW69785.1| Hop-interacting protein THI012 [Solanum lycopersi... 71 1e-10 gb|AEW69796.1| Hop-interacting protein THI033 [Solanum lycopersi... 69 3e-10 ref|XP_002533588.1| protein binding protein, putative [Ricinus c... 64 2e-08 ref|XP_002283974.1| PREDICTED: putative E3 ubiquitin-protein lig... 63 3e-08 ref|XP_002283965.1| PREDICTED: putative E3 ubiquitin-protein lig... 63 3e-08 >gb|AEW69785.1| Hop-interacting protein THI012 [Solanum lycopersicum] Length = 446 Score = 70.9 bits (172), Expect = 1e-10 Identities = 34/43 (79%), Positives = 37/43 (86%) Frame = +3 Query: 3 KLPKLRKPRNFSEGSSSFKGLSAVPSFGKMVGRGSGRVSVDNE 131 KL K R+ RNFSEGSSSFKGLSAV SFGKM GRGSGR++ DNE Sbjct: 395 KLRKTRRSRNFSEGSSSFKGLSAVSSFGKMTGRGSGRIAADNE 437 >gb|AEW69796.1| Hop-interacting protein THI033 [Solanum lycopersicum] Length = 447 Score = 69.3 bits (168), Expect = 3e-10 Identities = 33/43 (76%), Positives = 38/43 (88%) Frame = +3 Query: 3 KLPKLRKPRNFSEGSSSFKGLSAVPSFGKMVGRGSGRVSVDNE 131 KL K R+ RNFSEGSSSFKGLSAV SFG+MVGRGSGR++ +NE Sbjct: 396 KLRKSRRSRNFSEGSSSFKGLSAVSSFGRMVGRGSGRIAAENE 438 >ref|XP_002533588.1| protein binding protein, putative [Ricinus communis] gi|223526532|gb|EEF28793.1| protein binding protein, putative [Ricinus communis] Length = 221 Score = 63.5 bits (153), Expect = 2e-08 Identities = 32/44 (72%), Positives = 37/44 (84%), Gaps = 1/44 (2%) Frame = +3 Query: 3 KLPKLRKPRNFS-EGSSSFKGLSAVPSFGKMVGRGSGRVSVDNE 131 K+ K RK RNFS EGSSSFKGLSA+ SFGKM GRGSGR++ +NE Sbjct: 173 KMRKARKSRNFSSEGSSSFKGLSAISSFGKMGGRGSGRIAAENE 216 >ref|XP_002283974.1| PREDICTED: putative E3 ubiquitin-protein ligase XBAT31 isoform 2 [Vitis vinifera] Length = 438 Score = 62.8 bits (151), Expect = 3e-08 Identities = 31/43 (72%), Positives = 35/43 (81%) Frame = +3 Query: 3 KLPKLRKPRNFSEGSSSFKGLSAVPSFGKMVGRGSGRVSVDNE 131 KL + RK RN SEGSSSFKGLSAV SF KM GRGSGR++ +NE Sbjct: 391 KLRRSRKSRNLSEGSSSFKGLSAVGSFSKMGGRGSGRIAAENE 433 >ref|XP_002283965.1| PREDICTED: putative E3 ubiquitin-protein ligase XBAT31 isoform 1 [Vitis vinifera] Length = 445 Score = 62.8 bits (151), Expect = 3e-08 Identities = 31/43 (72%), Positives = 35/43 (81%) Frame = +3 Query: 3 KLPKLRKPRNFSEGSSSFKGLSAVPSFGKMVGRGSGRVSVDNE 131 KL + RK RN SEGSSSFKGLSAV SF KM GRGSGR++ +NE Sbjct: 398 KLRRSRKSRNLSEGSSSFKGLSAVGSFSKMGGRGSGRIAAENE 440