BLASTX nr result
ID: Atractylodes22_contig00006154
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00006154 (332 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002510007.1| Receptor protein kinase CLAVATA1 precursor, ... 63 1e-14 ref|XP_002283604.2| PREDICTED: receptor-like protein kinase HAIK... 63 3e-14 ref|XP_003522732.1| PREDICTED: receptor-like protein kinase HAIK... 59 2e-12 ref|XP_002889779.1| hypothetical protein ARALYDRAFT_888250 [Arab... 57 5e-12 ref|XP_002889783.1| hypothetical protein ARALYDRAFT_888256 [Arab... 57 5e-12 >ref|XP_002510007.1| Receptor protein kinase CLAVATA1 precursor, putative [Ricinus communis] gi|223550708|gb|EEF52194.1| Receptor protein kinase CLAVATA1 precursor, putative [Ricinus communis] Length = 973 Score = 62.8 bits (151), Expect(2) = 1e-14 Identities = 27/42 (64%), Positives = 37/42 (88%) Frame = -2 Query: 331 LSLVDSSIPEPYKEETIKVLKVAIMCTTRLPALRPTMRTVVK 206 LS+VDS IPE ++E+ +KVL++AI+CT RLP LRPTMR+VV+ Sbjct: 902 LSIVDSRIPEVFREDAVKVLRIAILCTARLPTLRPTMRSVVQ 943 Score = 41.2 bits (95), Expect(2) = 1e-14 Identities = 17/22 (77%), Positives = 22/22 (100%) Frame = -3 Query: 147 TMRTVVKMLEEAEPCKLVGIIV 82 TMR+VV+MLE+AEPCKLVGI++ Sbjct: 937 TMRSVVQMLEDAEPCKLVGIVI 958 >ref|XP_002283604.2| PREDICTED: receptor-like protein kinase HAIKU2-like [Vitis vinifera] Length = 984 Score = 63.2 bits (152), Expect(2) = 3e-14 Identities = 29/42 (69%), Positives = 36/42 (85%) Frame = -2 Query: 331 LSLVDSSIPEPYKEETIKVLKVAIMCTTRLPALRPTMRTVVK 206 LS+VDS IPE KE+ +KVL++AI+CT RLPALRPTMR VV+ Sbjct: 908 LSIVDSRIPEALKEDAVKVLRIAILCTARLPALRPTMRGVVQ 949 Score = 40.0 bits (92), Expect(2) = 3e-14 Identities = 18/22 (81%), Positives = 21/22 (95%) Frame = -3 Query: 147 TMRTVVKMLEEAEPCKLVGIIV 82 TMR VV+M+EEAEPC+LVGIIV Sbjct: 943 TMRGVVQMIEEAEPCRLVGIIV 964 >ref|XP_003522732.1| PREDICTED: receptor-like protein kinase HAIKU2-like [Glycine max] Length = 983 Score = 58.5 bits (140), Expect(2) = 2e-12 Identities = 28/41 (68%), Positives = 32/41 (78%) Frame = -2 Query: 328 SLVDSSIPEPYKEETIKVLKVAIMCTTRLPALRPTMRTVVK 206 S VDS IPE Y EET KVL+ A++CT LPALRPTMR VV+ Sbjct: 914 SAVDSRIPEMYTEETCKVLRTAVLCTGTLPALRPTMRAVVQ 954 Score = 38.5 bits (88), Expect(2) = 2e-12 Identities = 16/22 (72%), Positives = 20/22 (90%) Frame = -3 Query: 147 TMRTVVKMLEEAEPCKLVGIIV 82 TMR VV+ LE+AEPCKLVGI++ Sbjct: 948 TMRAVVQKLEDAEPCKLVGIVI 969 >ref|XP_002889779.1| hypothetical protein ARALYDRAFT_888250 [Arabidopsis lyrata subsp. lyrata] gi|297335621|gb|EFH66038.1| hypothetical protein ARALYDRAFT_888250 [Arabidopsis lyrata subsp. lyrata] Length = 976 Score = 57.4 bits (137), Expect(2) = 5e-12 Identities = 24/42 (57%), Positives = 34/42 (80%) Frame = -2 Query: 331 LSLVDSSIPEPYKEETIKVLKVAIMCTTRLPALRPTMRTVVK 206 + +VD I E Y+E+ IK+L++AI+CT RLP LRPTMR+VV+ Sbjct: 908 MEIVDKKIGEMYREDAIKILRIAILCTARLPGLRPTMRSVVQ 949 Score = 38.1 bits (87), Expect(2) = 5e-12 Identities = 14/22 (63%), Positives = 22/22 (100%) Frame = -3 Query: 147 TMRTVVKMLEEAEPCKLVGIIV 82 TMR+VV+M+E+AEPC+L+GI++ Sbjct: 943 TMRSVVQMIEDAEPCRLMGIVI 964 >ref|XP_002889783.1| hypothetical protein ARALYDRAFT_888256 [Arabidopsis lyrata subsp. lyrata] gi|297335625|gb|EFH66042.1| hypothetical protein ARALYDRAFT_888256 [Arabidopsis lyrata subsp. lyrata] Length = 729 Score = 57.4 bits (137), Expect(2) = 5e-12 Identities = 24/42 (57%), Positives = 34/42 (80%) Frame = -2 Query: 331 LSLVDSSIPEPYKEETIKVLKVAIMCTTRLPALRPTMRTVVK 206 + +VD I E Y+E+ IK+L++AI+CT RLP LRPTMR+VV+ Sbjct: 661 MEIVDKKIGEMYREDAIKILRIAILCTARLPGLRPTMRSVVQ 702 Score = 38.1 bits (87), Expect(2) = 5e-12 Identities = 14/22 (63%), Positives = 22/22 (100%) Frame = -3 Query: 147 TMRTVVKMLEEAEPCKLVGIIV 82 TMR+VV+M+E+AEPC+L+GI++ Sbjct: 696 TMRSVVQMIEDAEPCRLMGIVI 717