BLASTX nr result
ID: Atractylodes22_contig00005975
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00005975 (292 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ADZ24000.1| allene oxide synthase [Artemisia annua] 55 6e-06 >gb|ADZ24000.1| allene oxide synthase [Artemisia annua] Length = 526 Score = 55.1 bits (131), Expect = 6e-06 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = -3 Query: 290 VELFRRYDSFDIEVGESALGAAITLTSLKKAAV 192 +ELFRRYDSFDIEVG S LGA ITLTSLK+A V Sbjct: 494 IELFRRYDSFDIEVGASPLGAKITLTSLKRARV 526