BLASTX nr result
ID: Atractylodes22_contig00005369
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00005369 (435 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002509436.1| conserved hypothetical protein [Ricinus comm... 57 2e-06 ref|XP_002881310.1| hypothetical protein ARALYDRAFT_902473 [Arab... 56 3e-06 ref|NP_001078002.1| uncharacterized protein [Arabidopsis thalian... 56 3e-06 gb|ABK28329.1| unknown [Arabidopsis thaliana] 56 3e-06 ref|NP_001078001.1| uncharacterized protein [Arabidopsis thalian... 56 3e-06 >ref|XP_002509436.1| conserved hypothetical protein [Ricinus communis] gi|223549335|gb|EEF50823.1| conserved hypothetical protein [Ricinus communis] Length = 94 Score = 57.0 bits (136), Expect = 2e-06 Identities = 29/63 (46%), Positives = 39/63 (61%) Frame = -1 Query: 369 AARSPFRVPTQKPLSHRIFRSPVEMSCVALESMLPFHXXXXXXXXXXXXXXAPYSCGWTI 190 +A SPFR+P Q LS RIFRSPVEMSC ++E+MLP++ +P GWT Sbjct: 29 SAFSPFRIPKQNALSRRIFRSPVEMSC-SVETMLPYYTATASALLTSMLSVSPRCYGWTP 87 Query: 189 DGE 181 +G+ Sbjct: 88 EGQ 90 >ref|XP_002881310.1| hypothetical protein ARALYDRAFT_902473 [Arabidopsis lyrata subsp. lyrata] gi|297327149|gb|EFH57569.1| hypothetical protein ARALYDRAFT_902473 [Arabidopsis lyrata subsp. lyrata] Length = 99 Score = 55.8 bits (133), Expect = 3e-06 Identities = 25/37 (67%), Positives = 32/37 (86%) Frame = -1 Query: 369 AARSPFRVPTQKPLSHRIFRSPVEMSCVALESMLPFH 259 +ARS F++P Q PLSHRIFRSPVE+SC +E+MLP+H Sbjct: 29 SARSSFKLPKQSPLSHRIFRSPVELSC-CVETMLPYH 64 >ref|NP_001078002.1| uncharacterized protein [Arabidopsis thaliana] gi|330253803|gb|AEC08897.1| uncharacterized protein [Arabidopsis thaliana] Length = 89 Score = 55.8 bits (133), Expect = 3e-06 Identities = 25/37 (67%), Positives = 32/37 (86%) Frame = -1 Query: 369 AARSPFRVPTQKPLSHRIFRSPVEMSCVALESMLPFH 259 +ARS F++P Q PLSHRIFRSPVE+SC +E+MLP+H Sbjct: 29 SARSSFKLPKQSPLSHRIFRSPVELSC-CVETMLPYH 64 >gb|ABK28329.1| unknown [Arabidopsis thaliana] Length = 94 Score = 55.8 bits (133), Expect = 3e-06 Identities = 25/37 (67%), Positives = 32/37 (86%) Frame = -1 Query: 369 AARSPFRVPTQKPLSHRIFRSPVEMSCVALESMLPFH 259 +ARS F++P Q PLSHRIFRSPVE+SC +E+MLP+H Sbjct: 29 SARSSFKLPKQSPLSHRIFRSPVELSC-CVETMLPYH 64 >ref|NP_001078001.1| uncharacterized protein [Arabidopsis thaliana] gi|98961761|gb|ABF59210.1| unknown protein [Arabidopsis thaliana] gi|330253802|gb|AEC08896.1| uncharacterized protein [Arabidopsis thaliana] Length = 93 Score = 55.8 bits (133), Expect = 3e-06 Identities = 25/37 (67%), Positives = 32/37 (86%) Frame = -1 Query: 369 AARSPFRVPTQKPLSHRIFRSPVEMSCVALESMLPFH 259 +ARS F++P Q PLSHRIFRSPVE+SC +E+MLP+H Sbjct: 29 SARSSFKLPKQSPLSHRIFRSPVELSC-CVETMLPYH 64