BLASTX nr result
ID: Atractylodes22_contig00005297
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00005297 (455 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI17872.3| unnamed protein product [Vitis vinifera] 155 3e-36 ref|XP_002266525.1| PREDICTED: glutaredoxin-C4-like [Vitis vinif... 155 3e-36 ref|XP_002325236.1| glutaredoxin C4 [Populus trichocarpa] gi|118... 155 3e-36 gb|AAL90750.1| glutaredoxin [Populus tremula x Populus tremuloides] 154 9e-36 ref|NP_197550.1| glutaredoxin-C4 [Arabidopsis thaliana] gi|11937... 151 6e-35 >emb|CBI17872.3| unnamed protein product [Vitis vinifera] Length = 136 Score = 155 bits (392), Expect = 3e-36 Identities = 73/90 (81%), Positives = 80/90 (88%) Frame = +3 Query: 3 IFSKSYCPYCKRAKGVFKELNKKPYVIELDEREDGWKIQDALSEIVGRRTVPQVFINGKH 182 IFSKSYCPYCKRAK VFKELN+ PYV+ELD+REDGW IQDALS +VGRRTVPQVFINGKH Sbjct: 47 IFSKSYCPYCKRAKAVFKELNQVPYVVELDQREDGWNIQDALSGMVGRRTVPQVFINGKH 106 Query: 183 LGGSDDTVEAYESGQLAELLGIASRHRTDL 272 +GGSDDTVEAY+SG LA+LLGIA DL Sbjct: 107 IGGSDDTVEAYQSGDLAKLLGIAEEDSDDL 136 >ref|XP_002266525.1| PREDICTED: glutaredoxin-C4-like [Vitis vinifera] Length = 140 Score = 155 bits (392), Expect = 3e-36 Identities = 73/90 (81%), Positives = 80/90 (88%) Frame = +3 Query: 3 IFSKSYCPYCKRAKGVFKELNKKPYVIELDEREDGWKIQDALSEIVGRRTVPQVFINGKH 182 IFSKSYCPYCKRAK VFKELN+ PYV+ELD+REDGW IQDALS +VGRRTVPQVFINGKH Sbjct: 51 IFSKSYCPYCKRAKAVFKELNQVPYVVELDQREDGWNIQDALSGMVGRRTVPQVFINGKH 110 Query: 183 LGGSDDTVEAYESGQLAELLGIASRHRTDL 272 +GGSDDTVEAY+SG LA+LLGIA DL Sbjct: 111 IGGSDDTVEAYQSGDLAKLLGIAEEDSDDL 140 >ref|XP_002325236.1| glutaredoxin C4 [Populus trichocarpa] gi|118483557|gb|ABK93676.1| unknown [Populus trichocarpa] gi|118488597|gb|ABK96111.1| unknown [Populus trichocarpa] gi|222866670|gb|EEF03801.1| glutaredoxin C4 [Populus trichocarpa] Length = 136 Score = 155 bits (392), Expect = 3e-36 Identities = 72/90 (80%), Positives = 84/90 (93%) Frame = +3 Query: 3 IFSKSYCPYCKRAKGVFKELNKKPYVIELDEREDGWKIQDALSEIVGRRTVPQVFINGKH 182 IFSKSYCPYCK+AKGVFKELN+ P+V+ELD+REDG IQDA+SEIVGRRTVPQVFI+GKH Sbjct: 47 IFSKSYCPYCKKAKGVFKELNQTPHVVELDQREDGHDIQDAMSEIVGRRTVPQVFIDGKH 106 Query: 183 LGGSDDTVEAYESGQLAELLGIASRHRTDL 272 +GGSDDTVEAYESG+LA+LLG+AS + DL Sbjct: 107 IGGSDDTVEAYESGELAKLLGVASEQKDDL 136 >gb|AAL90750.1| glutaredoxin [Populus tremula x Populus tremuloides] Length = 139 Score = 154 bits (388), Expect = 9e-36 Identities = 71/89 (79%), Positives = 83/89 (93%) Frame = +3 Query: 3 IFSKSYCPYCKRAKGVFKELNKKPYVIELDEREDGWKIQDALSEIVGRRTVPQVFINGKH 182 IFSKSYCPYCK+AKGVFKELN+ P+V+ELD+REDG IQDA+SEIVGRRTVPQVFI+GKH Sbjct: 47 IFSKSYCPYCKKAKGVFKELNQTPHVVELDQREDGHDIQDAMSEIVGRRTVPQVFIDGKH 106 Query: 183 LGGSDDTVEAYESGQLAELLGIASRHRTD 269 +GGSDDTVEAYESG+LA+LLG+AS + D Sbjct: 107 IGGSDDTVEAYESGELAKLLGVASEQKDD 135 >ref|NP_197550.1| glutaredoxin-C4 [Arabidopsis thaliana] gi|119370637|sp|Q8LFQ6.2|GRXC4_ARATH RecName: Full=Glutaredoxin-C4; Short=AtGrxC4 gi|6735386|emb|CAB69043.1| glutaredoxin [Arabidopsis thaliana] gi|25082927|gb|AAN72016.1| glutaredoxin [Arabidopsis thaliana] gi|25082941|gb|AAN72019.1| glutaredoxin [Arabidopsis thaliana] gi|98960865|gb|ABF58916.1| At5g20500 [Arabidopsis thaliana] gi|332005470|gb|AED92853.1| glutaredoxin-C4 [Arabidopsis thaliana] Length = 135 Score = 151 bits (381), Expect = 6e-35 Identities = 69/90 (76%), Positives = 80/90 (88%) Frame = +3 Query: 3 IFSKSYCPYCKRAKGVFKELNKKPYVIELDEREDGWKIQDALSEIVGRRTVPQVFINGKH 182 IFSKSYCPYCK+AK VF+EL++ PYV+ELDEREDGW IQ AL EIVGRRTVPQVFINGKH Sbjct: 46 IFSKSYCPYCKKAKSVFRELDQVPYVVELDEREDGWSIQTALGEIVGRRTVPQVFINGKH 105 Query: 183 LGGSDDTVEAYESGQLAELLGIASRHRTDL 272 LGGSDDTV+AYESG+LA+LLG++ +L Sbjct: 106 LGGSDDTVDAYESGELAKLLGVSGNKEAEL 135