BLASTX nr result
ID: Atractylodes22_contig00005060
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00005060 (475 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFW76483.1| putative ATPase, V1 complex, subunit B protein [Z... 150 1e-34 gb|AAC36485.1| nucleotide-binding subunit of vacuolar ATPase [Ar... 149 2e-34 gb|AAF88162.1|AC026234_13 Nearly identical to vacuolar ATP synth... 149 2e-34 dbj|BAD43490.1| vacuolar-type H+-ATPase subunit B3 (VHA-B3) [Ara... 149 2e-34 dbj|BAD42932.1| vacuolar-type H+-ATPase subunit B3 (VHA-B3) [Ara... 149 2e-34 >gb|AFW76483.1| putative ATPase, V1 complex, subunit B protein [Zea mays] Length = 382 Score = 150 bits (379), Expect = 1e-34 Identities = 72/74 (97%), Positives = 73/74 (98%) Frame = +3 Query: 3 ATIYERAGRIEGRKGSITQIPILTMPNDDITHPTPDLTGYITEGQIYIDRQLHNRQIYPP 182 ATIYERAGRIEGR GSITQIPILTMPNDDITHPTPDLTGYITEGQIYIDRQLHNRQIYPP Sbjct: 309 ATIYERAGRIEGRTGSITQIPILTMPNDDITHPTPDLTGYITEGQIYIDRQLHNRQIYPP 368 Query: 183 INVLPSLSRLMKIR 224 INVLPSLSRLMK+R Sbjct: 369 INVLPSLSRLMKVR 382 >gb|AAC36485.1| nucleotide-binding subunit of vacuolar ATPase [Arabidopsis thaliana] Length = 492 Score = 149 bits (377), Expect = 2e-34 Identities = 72/72 (100%), Positives = 72/72 (100%) Frame = +3 Query: 3 ATIYERAGRIEGRKGSITQIPILTMPNDDITHPTPDLTGYITEGQIYIDRQLHNRQIYPP 182 ATIYERAGRIEGRKGSITQIPILTMPNDDITHPTPDLTGYITEGQIYIDRQLHNRQIYPP Sbjct: 314 ATIYERAGRIEGRKGSITQIPILTMPNDDITHPTPDLTGYITEGQIYIDRQLHNRQIYPP 373 Query: 183 INVLPSLSRLMK 218 INVLPSLSRLMK Sbjct: 374 INVLPSLSRLMK 385 >gb|AAF88162.1|AC026234_13 Nearly identical to vacuolar ATP synthase subunit B (V-atpase B subunit)(V-atpase 57 KD subunit) from Arabidopsis thaliana gi|137465 and is a member of ATP synthase alpha/beta PF|00006 family and contains an ATP synthase beta chain PF|01038 domain. ESTs gb|F14109, gb|AA650677, gb|N65767, gb|BE038735, gb|T88157, gb|F14079, gb|H76885, gb|N96777, gb|T14042 come from this gene [Arabidopsis thaliana] Length = 485 Score = 149 bits (377), Expect = 2e-34 Identities = 72/72 (100%), Positives = 72/72 (100%) Frame = +3 Query: 3 ATIYERAGRIEGRKGSITQIPILTMPNDDITHPTPDLTGYITEGQIYIDRQLHNRQIYPP 182 ATIYERAGRIEGRKGSITQIPILTMPNDDITHPTPDLTGYITEGQIYIDRQLHNRQIYPP Sbjct: 307 ATIYERAGRIEGRKGSITQIPILTMPNDDITHPTPDLTGYITEGQIYIDRQLHNRQIYPP 366 Query: 183 INVLPSLSRLMK 218 INVLPSLSRLMK Sbjct: 367 INVLPSLSRLMK 378 >dbj|BAD43490.1| vacuolar-type H+-ATPase subunit B3 (VHA-B3) [Arabidopsis thaliana] Length = 277 Score = 149 bits (377), Expect = 2e-34 Identities = 72/72 (100%), Positives = 72/72 (100%) Frame = +3 Query: 3 ATIYERAGRIEGRKGSITQIPILTMPNDDITHPTPDLTGYITEGQIYIDRQLHNRQIYPP 182 ATIYERAGRIEGRKGSITQIPILTMPNDDITHPTPDLTGYITEGQIYIDRQLHNRQIYPP Sbjct: 99 ATIYERAGRIEGRKGSITQIPILTMPNDDITHPTPDLTGYITEGQIYIDRQLHNRQIYPP 158 Query: 183 INVLPSLSRLMK 218 INVLPSLSRLMK Sbjct: 159 INVLPSLSRLMK 170 >dbj|BAD42932.1| vacuolar-type H+-ATPase subunit B3 (VHA-B3) [Arabidopsis thaliana] Length = 273 Score = 149 bits (377), Expect = 2e-34 Identities = 72/72 (100%), Positives = 72/72 (100%) Frame = +3 Query: 3 ATIYERAGRIEGRKGSITQIPILTMPNDDITHPTPDLTGYITEGQIYIDRQLHNRQIYPP 182 ATIYERAGRIEGRKGSITQIPILTMPNDDITHPTPDLTGYITEGQIYIDRQLHNRQIYPP Sbjct: 95 ATIYERAGRIEGRKGSITQIPILTMPNDDITHPTPDLTGYITEGQIYIDRQLHNRQIYPP 154 Query: 183 INVLPSLSRLMK 218 INVLPSLSRLMK Sbjct: 155 INVLPSLSRLMK 166