BLASTX nr result
ID: Atractylodes22_contig00004572
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00004572 (255 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003519473.1| PREDICTED: ribosomal RNA assembly protein mi... 57 2e-06 ref|NP_001241422.1| uncharacterized protein LOC100816856 [Glycin... 57 2e-06 ref|XP_002513405.1| Ribosomal RNA assembly protein mis3, putativ... 57 2e-06 gb|AFK40254.1| unknown [Medicago truncatula] 56 4e-06 ref|XP_003617063.1| KRR1 small subunit processome component-like... 56 4e-06 >ref|XP_003519473.1| PREDICTED: ribosomal RNA assembly protein mis3-like [Glycine max] Length = 389 Score = 56.6 bits (135), Expect = 2e-06 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = -3 Query: 244 SAKKWQERQEKQAEKTAENKRKREEAFKPSK 152 SAK WQE+QEKQAEKTAENKRKREEAF P K Sbjct: 297 SAKIWQEKQEKQAEKTAENKRKREEAFIPPK 327 >ref|NP_001241422.1| uncharacterized protein LOC100816856 [Glycine max] gi|255639399|gb|ACU19995.1| unknown [Glycine max] Length = 389 Score = 56.6 bits (135), Expect = 2e-06 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = -3 Query: 244 SAKKWQERQEKQAEKTAENKRKREEAFKPSK 152 SAK WQE+QEKQAEKTAENKRKREEAF P K Sbjct: 297 SAKIWQEKQEKQAEKTAENKRKREEAFIPPK 327 >ref|XP_002513405.1| Ribosomal RNA assembly protein mis3, putative [Ricinus communis] gi|223547313|gb|EEF48808.1| Ribosomal RNA assembly protein mis3, putative [Ricinus communis] Length = 377 Score = 56.6 bits (135), Expect = 2e-06 Identities = 26/40 (65%), Positives = 30/40 (75%) Frame = -3 Query: 241 AKKWQERQEKQAEKTAENKRKREEAFKPSKRFNSDAAGNS 122 AKKWQE+QE+QAEKTAENKRKR+ AF P + AG S Sbjct: 285 AKKWQEKQERQAEKTAENKRKRDTAFVPPEEHRDQDAGKS 324 >gb|AFK40254.1| unknown [Medicago truncatula] Length = 380 Score = 55.8 bits (133), Expect = 4e-06 Identities = 28/41 (68%), Positives = 33/41 (80%) Frame = -3 Query: 244 SAKKWQERQEKQAEKTAENKRKREEAFKPSKRFNSDAAGNS 122 SAKKWQERQ +QAEKTAENKRKR+E+F P K ++ GNS Sbjct: 288 SAKKWQERQVQQAEKTAENKRKRDESFVPPKE-PANLVGNS 327 >ref|XP_003617063.1| KRR1 small subunit processome component-like protein [Medicago truncatula] gi|355518398|gb|AET00022.1| KRR1 small subunit processome component-like protein [Medicago truncatula] Length = 424 Score = 55.8 bits (133), Expect = 4e-06 Identities = 28/41 (68%), Positives = 33/41 (80%) Frame = -3 Query: 244 SAKKWQERQEKQAEKTAENKRKREEAFKPSKRFNSDAAGNS 122 SAKKWQERQ +QAEKTAENKRKR+E+F P K ++ GNS Sbjct: 332 SAKKWQERQVQQAEKTAENKRKRDESFVPPKE-PANLVGNS 371