BLASTX nr result
ID: Atractylodes22_contig00003981
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00003981 (382 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value sp|O82067.3|TOM7A_SOLTU RecName: Full=Mitochondrial import recep... 84 1e-14 gb|AFK44684.1| unknown [Lotus japonicus] 82 5e-14 ref|XP_004151870.1| PREDICTED: mitochondrial import receptor sub... 81 8e-14 ref|XP_002523617.1| Mitochondrial import receptor subunit TOM7-1... 81 8e-14 ref|XP_003525317.1| PREDICTED: mitochondrial import receptor sub... 80 1e-13 >sp|O82067.3|TOM7A_SOLTU RecName: Full=Mitochondrial import receptor subunit TOM7-1; AltName: Full=Translocase of outer membrane 7 kDa subunit 1 gi|3319774|emb|CAA76125.1| TOM7 protein [Solanum tuberosum] Length = 72 Score = 84.0 bits (206), Expect = 1e-14 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +1 Query: 181 EWSTWTMKKAKVLTHYGFIPVVIIIGMNSEPKPSLSQLLSPV 306 EW TWT KKAKV+THYGFIP+VIIIGMNSEPKPSLSQLLSPV Sbjct: 31 EWGTWTAKKAKVITHYGFIPLVIIIGMNSEPKPSLSQLLSPV 72 >gb|AFK44684.1| unknown [Lotus japonicus] Length = 72 Score = 82.0 bits (201), Expect = 5e-14 Identities = 35/42 (83%), Positives = 41/42 (97%) Frame = +1 Query: 181 EWSTWTMKKAKVLTHYGFIPVVIIIGMNSEPKPSLSQLLSPV 306 EW+TWTM+KAKV+THYGFIP++IIIGMNS+PKP LSQLLSPV Sbjct: 31 EWTTWTMRKAKVVTHYGFIPLIIIIGMNSDPKPQLSQLLSPV 72 >ref|XP_004151870.1| PREDICTED: mitochondrial import receptor subunit TOM7-1-like [Cucumis sativus] gi|449516268|ref|XP_004165169.1| PREDICTED: mitochondrial import receptor subunit TOM7-1-like [Cucumis sativus] Length = 73 Score = 81.3 bits (199), Expect = 8e-14 Identities = 36/42 (85%), Positives = 40/42 (95%) Frame = +1 Query: 181 EWSTWTMKKAKVLTHYGFIPVVIIIGMNSEPKPSLSQLLSPV 306 EW+TW +KKAKV+THYGFIP+VIIIGMNSEPKP LSQLLSPV Sbjct: 32 EWTTWAVKKAKVVTHYGFIPLVIIIGMNSEPKPQLSQLLSPV 73 >ref|XP_002523617.1| Mitochondrial import receptor subunit TOM7-1, putative [Ricinus communis] gi|223537179|gb|EEF38812.1| Mitochondrial import receptor subunit TOM7-1, putative [Ricinus communis] Length = 75 Score = 81.3 bits (199), Expect = 8e-14 Identities = 35/42 (83%), Positives = 40/42 (95%) Frame = +1 Query: 181 EWSTWTMKKAKVLTHYGFIPVVIIIGMNSEPKPSLSQLLSPV 306 EWSTWT+KKAKV+THYGFIP+V+IIGMNSEPKP L QLL+PV Sbjct: 34 EWSTWTLKKAKVITHYGFIPLVVIIGMNSEPKPQLYQLLTPV 75 >ref|XP_003525317.1| PREDICTED: mitochondrial import receptor subunit TOM7-1-like isoform 1 [Glycine max] gi|356513233|ref|XP_003525318.1| PREDICTED: mitochondrial import receptor subunit TOM7-1-like isoform 2 [Glycine max] Length = 72 Score = 80.5 bits (197), Expect = 1e-13 Identities = 35/42 (83%), Positives = 40/42 (95%) Frame = +1 Query: 181 EWSTWTMKKAKVLTHYGFIPVVIIIGMNSEPKPSLSQLLSPV 306 EW+TW M+KAKV+THYGFIP+VIIIGMNS+PKP LSQLLSPV Sbjct: 31 EWTTWAMRKAKVITHYGFIPLVIIIGMNSDPKPPLSQLLSPV 72