BLASTX nr result
ID: Atractylodes22_contig00003853
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00003853 (1211 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002524867.1| cysteine synthase, putative [Ricinus communi... 66 2e-08 emb|CAA57498.1| cysteine synthase [Arabidopsis thaliana] 60 2e-08 ref|XP_003632085.1| PREDICTED: cysteine synthase, chloroplastic/... 64 6e-08 ref|XP_002277485.1| PREDICTED: cysteine synthase, chloroplastic/... 64 6e-08 ref|XP_002330649.1| predicted protein [Populus trichocarpa] gi|2... 64 8e-08 >ref|XP_002524867.1| cysteine synthase, putative [Ricinus communis] gi|223535830|gb|EEF37491.1| cysteine synthase, putative [Ricinus communis] Length = 408 Score = 66.2 bits (160), Expect = 2e-08 Identities = 31/47 (65%), Positives = 41/47 (87%) Frame = +3 Query: 1071 LSNVGADIVLTDSSMGIK*AVQKADKIVNSTPHAHMLQQFDDPANPK 1211 L GA++VLTDS+ G+K AVQKA++I+ STP+A+MLQQFD+PANPK Sbjct: 195 LKAFGAELVLTDSAKGMKGAVQKAEEILKSTPNAYMLQQFDNPANPK 241 >emb|CAA57498.1| cysteine synthase [Arabidopsis thaliana] Length = 424 Score = 60.1 bits (144), Expect(2) = 2e-08 Identities = 28/47 (59%), Positives = 38/47 (80%) Frame = +3 Query: 1071 LSNVGADIVLTDSSMGIK*AVQKADKIVNSTPHAHMLQQFDDPANPK 1211 L GA++VLTD + G+ AVQKA++I+ +TP A+MLQQFD+PANPK Sbjct: 210 LKAFGAELVLTDPAKGMTGAVQKAEEILKNTPDAYMLQQFDNPANPK 256 Score = 25.4 bits (54), Expect(2) = 2e-08 Identities = 12/30 (40%), Positives = 18/30 (60%) Frame = +2 Query: 911 CLNSLDKDGNNMIVDAEEKGEEKGITTPGK 1000 C + D+ G +M+ DA E+KG +PGK Sbjct: 144 CCSVKDRIGYSMVTDA----EQKGFISPGK 169 >ref|XP_003632085.1| PREDICTED: cysteine synthase, chloroplastic/chromoplastic isoform 2 [Vitis vinifera] Length = 373 Score = 64.3 bits (155), Expect = 6e-08 Identities = 30/47 (63%), Positives = 40/47 (85%) Frame = +3 Query: 1071 LSNVGADIVLTDSSMGIK*AVQKADKIVNSTPHAHMLQQFDDPANPK 1211 L GA++VLTD + G+K AVQKA++I+ STP+A+MLQQFD+PANPK Sbjct: 169 LKAFGAELVLTDPAKGMKGAVQKAEEILKSTPNAYMLQQFDNPANPK 215 >ref|XP_002277485.1| PREDICTED: cysteine synthase, chloroplastic/chromoplastic isoform 1 [Vitis vinifera] gi|296084309|emb|CBI24697.3| unnamed protein product [Vitis vinifera] Length = 382 Score = 64.3 bits (155), Expect = 6e-08 Identities = 30/47 (63%), Positives = 40/47 (85%) Frame = +3 Query: 1071 LSNVGADIVLTDSSMGIK*AVQKADKIVNSTPHAHMLQQFDDPANPK 1211 L GA++VLTD + G+K AVQKA++I+ STP+A+MLQQFD+PANPK Sbjct: 169 LKAFGAELVLTDPAKGMKGAVQKAEEILKSTPNAYMLQQFDNPANPK 215 >ref|XP_002330649.1| predicted protein [Populus trichocarpa] gi|222872253|gb|EEF09384.1| predicted protein [Populus trichocarpa] Length = 336 Score = 63.9 bits (154), Expect = 8e-08 Identities = 29/43 (67%), Positives = 39/43 (90%) Frame = +3 Query: 1083 GADIVLTDSSMGIK*AVQKADKIVNSTPHAHMLQQFDDPANPK 1211 GA++VLTD++ G+K AVQKA++IV TP+A+MLQQFD+PANPK Sbjct: 128 GAELVLTDAAKGMKGAVQKAEEIVKRTPNAYMLQQFDNPANPK 170