BLASTX nr result
ID: Atractylodes22_contig00003749
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00003749 (394 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAA32772.1| regulatory protein [Arabidopsis thaliana] 64 1e-08 ref|NP_180854.1| E3 ubiquitin-protein ligase COP1 [Arabidopsis t... 64 1e-08 ref|XP_002270330.2| PREDICTED: E3 ubiquitin-protein ligase COP1-... 64 1e-08 gb|AEE81754.1| constitutively photomorphogenic 1 [Brassica rapa ... 64 1e-08 gb|ADL59932.1| constitutively photomorphogenic 1 [Brassica napus] 64 1e-08 >gb|AAA32772.1| regulatory protein [Arabidopsis thaliana] Length = 675 Score = 63.9 bits (154), Expect = 1e-08 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = +1 Query: 1 YFISAVCWKSDAPTMLTANSQGTIKVLVLAA 93 YFISAVCWKSD+PTMLTANSQGTIKVLVLAA Sbjct: 645 YFISAVCWKSDSPTMLTANSQGTIKVLVLAA 675 >ref|NP_180854.1| E3 ubiquitin-protein ligase COP1 [Arabidopsis thaliana] gi|20141387|sp|P43254.2|COP1_ARATH RecName: Full=E3 ubiquitin-protein ligase COP1; AltName: Full=Constitutive photomorphogenesis protein 1 gi|2702280|gb|AAB91983.1| COP1 regulatory protein [Arabidopsis thaliana] gi|95147316|gb|ABF57293.1| At2g32950 [Arabidopsis thaliana] gi|330253672|gb|AEC08766.1| E3 ubiquitin-protein ligase COP1 [Arabidopsis thaliana] Length = 675 Score = 63.9 bits (154), Expect = 1e-08 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = +1 Query: 1 YFISAVCWKSDAPTMLTANSQGTIKVLVLAA 93 YFISAVCWKSD+PTMLTANSQGTIKVLVLAA Sbjct: 645 YFISAVCWKSDSPTMLTANSQGTIKVLVLAA 675 >ref|XP_002270330.2| PREDICTED: E3 ubiquitin-protein ligase COP1-like [Vitis vinifera] Length = 687 Score = 63.9 bits (154), Expect = 1e-08 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = +1 Query: 1 YFISAVCWKSDAPTMLTANSQGTIKVLVLAA 93 YFISAVCWKSD+PTMLTANSQGTIKVLVLAA Sbjct: 657 YFISAVCWKSDSPTMLTANSQGTIKVLVLAA 687 >gb|AEE81754.1| constitutively photomorphogenic 1 [Brassica rapa subsp. rapa] Length = 677 Score = 63.9 bits (154), Expect = 1e-08 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = +1 Query: 1 YFISAVCWKSDAPTMLTANSQGTIKVLVLAA 93 YFISAVCWKSD+PTMLTANSQGTIKVLVLAA Sbjct: 647 YFISAVCWKSDSPTMLTANSQGTIKVLVLAA 677 >gb|ADL59932.1| constitutively photomorphogenic 1 [Brassica napus] Length = 677 Score = 63.9 bits (154), Expect = 1e-08 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = +1 Query: 1 YFISAVCWKSDAPTMLTANSQGTIKVLVLAA 93 YFISAVCWKSD+PTMLTANSQGTIKVLVLAA Sbjct: 647 YFISAVCWKSDSPTMLTANSQGTIKVLVLAA 677