BLASTX nr result
ID: Atractylodes22_contig00003475
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00003475 (768 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value sp|Q10993.1|CYTB_HELAN RecName: Full=Cysteine proteinase inhibit... 73 6e-11 pir||JE0308 cysteine proteinase inhibitor - common sunflower 72 1e-10 gb|AEQ54766.1| cysteine proteinase inhibitor CPI-1 [Coffea canep... 65 1e-08 gb|AAO18638.1| cystatin [Malus x domestica] 60 4e-07 ref|XP_003538534.1| PREDICTED: cysteine proteinase inhibitor 2 [... 59 1e-06 >sp|Q10993.1|CYTB_HELAN RecName: Full=Cysteine proteinase inhibitor B; AltName: Full=Cystatin-B; AltName: Full=SCB Length = 101 Score = 73.2 bits (178), Expect = 6e-11 Identities = 35/51 (68%), Positives = 40/51 (78%) Frame = -1 Query: 768 ETQVVSGIKYYLEIETIAKSGVSKVFHAEVVVKPWMHSKQLLTFKPSPVSK 616 ETQVV+G KYYL+IE I K G KVF AEVVV+ W HSK+LL FKP+PV K Sbjct: 51 ETQVVAGTKYYLKIEAITKGGKMKVFDAEVVVQSWKHSKKLLGFKPAPVDK 101 >pir||JE0308 cysteine proteinase inhibitor - common sunflower Length = 123 Score = 72.4 bits (176), Expect = 1e-10 Identities = 35/51 (68%), Positives = 40/51 (78%) Frame = -1 Query: 768 ETQVVSGIKYYLEIETIAKSGVSKVFHAEVVVKPWMHSKQLLTFKPSPVSK 616 ETQVV+G KYYL+IE I K G KVF AEVVV+ W HSK+LL FKP+PV K Sbjct: 73 ETQVVAGTKYYLKIEAIYKGGKMKVFDAEVVVQSWKHSKKLLGFKPAPVDK 123 >gb|AEQ54766.1| cysteine proteinase inhibitor CPI-1 [Coffea canephora] Length = 139 Score = 65.5 bits (158), Expect = 1e-08 Identities = 32/53 (60%), Positives = 40/53 (75%), Gaps = 2/53 (3%) Frame = -1 Query: 768 ETQVVSGIKYYLEIETIAKSGVSKVFHAEVVVKPWMHSK--QLLTFKPSPVSK 616 E QVV+GIKYYL+I+ SGV KV+ A VVV+PW+H+K QLL F PSP +K Sbjct: 87 EKQVVAGIKYYLKIKATTSSGVPKVYDAIVVVRPWVHTKPRQLLNFSPSPATK 139 >gb|AAO18638.1| cystatin [Malus x domestica] Length = 123 Score = 60.5 bits (145), Expect = 4e-07 Identities = 27/46 (58%), Positives = 38/46 (82%) Frame = -1 Query: 768 ETQVVSGIKYYLEIETIAKSGVSKVFHAEVVVKPWMHSKQLLTFKP 631 ++QVVSGIKYYL++ + ++GV ++F +EVVVKPW+ SKQLL F P Sbjct: 75 QSQVVSGIKYYLKVSAV-RNGVHRLFDSEVVVKPWLRSKQLLNFAP 119 >ref|XP_003538534.1| PREDICTED: cysteine proteinase inhibitor 2 [Glycine max] Length = 126 Score = 58.9 bits (141), Expect = 1e-06 Identities = 32/52 (61%), Positives = 39/52 (75%), Gaps = 1/52 (1%) Frame = -1 Query: 768 ETQVVSGIKYYLEIETIAKSGVSKVFHAEVVVKPWMHSKQLLTFKP-SPVSK 616 + QVVSG+KYYL+I K GV K+F + VVVKPW+HSKQLL F P +P SK Sbjct: 74 QQQVVSGMKYYLKISATHK-GVHKMFTSVVVVKPWLHSKQLLHFAPAAPSSK 124