BLASTX nr result
ID: Atractylodes22_contig00003402
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00003402 (2905 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI35971.3| unnamed protein product [Vitis vinifera] 65 1e-25 ref|XP_002276212.2| PREDICTED: ABC transporter C family member 8... 65 1e-25 ref|XP_003529736.1| PREDICTED: ABC transporter C family member 8... 67 2e-25 ref|NP_001189944.1| multidrug resistance-associated protein 6 [A... 66 2e-25 ref|NP_188762.3| multidrug resistance-associated protein 6 [Arab... 66 2e-25 >emb|CBI35971.3| unnamed protein product [Vitis vinifera] Length = 2772 Score = 65.1 bits (157), Expect(3) = 1e-25 Identities = 33/47 (70%), Positives = 39/47 (82%) Frame = -2 Query: 2703 LLVLIPKGFVPSELVGLSLSYELTLTKGTRVFLIRWYCSLANYIISV 2563 LLVL+PKG V LVGLSLSY L LT G++VFL RWYC+L+NYI+SV Sbjct: 2444 LLVLLPKGVVVPGLVGLSLSYALALT-GSQVFLSRWYCNLSNYIVSV 2489 Score = 65.1 bits (157), Expect(3) = 1e-25 Identities = 27/34 (79%), Positives = 31/34 (91%) Frame = -3 Query: 2537 SWPSKGTIQFQELKLRYRPNAPLVLKGVTCTFKE 2436 SWPSKG I+ Q LK++YRPNAPLVLKG+TCTFKE Sbjct: 2514 SWPSKGRIELQNLKIKYRPNAPLVLKGITCTFKE 2547 Score = 35.4 bits (80), Expect(3) = 1e-25 Identities = 15/23 (65%), Positives = 18/23 (78%) Frame = -1 Query: 2779 SNATLEWLILRTEVFSNLTLFTA 2711 SNA +EWL+LR E+ NLTL TA Sbjct: 2419 SNAAIEWLVLRIEMLQNLTLVTA 2441 Score = 65.1 bits (157), Expect(2) = 5e-20 Identities = 32/47 (68%), Positives = 39/47 (82%) Frame = -2 Query: 2703 LLVLIPKGFVPSELVGLSLSYELTLTKGTRVFLIRWYCSLANYIISV 2563 LLVL+PKG+V LVGLSLSY L LT GT+V L RWYC+L+NY++SV Sbjct: 1070 LLVLLPKGYVAPGLVGLSLSYALALT-GTQVMLSRWYCNLSNYMVSV 1115 Score = 61.6 bits (148), Expect(2) = 5e-20 Identities = 25/34 (73%), Positives = 30/34 (88%) Frame = -3 Query: 2537 SWPSKGTIQFQELKLRYRPNAPLVLKGVTCTFKE 2436 SWPSKG I+ Q LK++YRPN+PLVLKG+TC FKE Sbjct: 1140 SWPSKGRIELQNLKIKYRPNSPLVLKGITCIFKE 1173 >ref|XP_002276212.2| PREDICTED: ABC transporter C family member 8-like [Vitis vinifera] Length = 1469 Score = 65.1 bits (157), Expect(3) = 1e-25 Identities = 33/47 (70%), Positives = 39/47 (82%) Frame = -2 Query: 2703 LLVLIPKGFVPSELVGLSLSYELTLTKGTRVFLIRWYCSLANYIISV 2563 LLVL+PKG V LVGLSLSY L LT G++VFL RWYC+L+NYI+SV Sbjct: 1141 LLVLLPKGVVVPGLVGLSLSYALALT-GSQVFLSRWYCNLSNYIVSV 1186 Score = 65.1 bits (157), Expect(3) = 1e-25 Identities = 27/34 (79%), Positives = 31/34 (91%) Frame = -3 Query: 2537 SWPSKGTIQFQELKLRYRPNAPLVLKGVTCTFKE 2436 SWPSKG I+ Q LK++YRPNAPLVLKG+TCTFKE Sbjct: 1211 SWPSKGRIELQNLKIKYRPNAPLVLKGITCTFKE 1244 Score = 35.4 bits (80), Expect(3) = 1e-25 Identities = 15/23 (65%), Positives = 18/23 (78%) Frame = -1 Query: 2779 SNATLEWLILRTEVFSNLTLFTA 2711 SNA +EWL+LR E+ NLTL TA Sbjct: 1116 SNAAIEWLVLRIEMLQNLTLVTA 1138 >ref|XP_003529736.1| PREDICTED: ABC transporter C family member 8-like [Glycine max] Length = 1951 Score = 67.4 bits (163), Expect(3) = 2e-25 Identities = 33/47 (70%), Positives = 39/47 (82%) Frame = -2 Query: 2703 LLVLIPKGFVPSELVGLSLSYELTLTKGTRVFLIRWYCSLANYIISV 2563 LLVL+P+G+V LVGLSLSY TLT GT++FL RWYC+L NYIISV Sbjct: 1621 LLVLVPQGYVSPGLVGLSLSYTFTLT-GTQIFLTRWYCNLLNYIISV 1666 Score = 63.5 bits (153), Expect(3) = 2e-25 Identities = 27/34 (79%), Positives = 30/34 (88%) Frame = -3 Query: 2537 SWPSKGTIQFQELKLRYRPNAPLVLKGVTCTFKE 2436 SWPSKG I Q L++RYRPNAPLVLKG+TCTFKE Sbjct: 1691 SWPSKGRIDLQALEIRYRPNAPLVLKGITCTFKE 1724 Score = 34.3 bits (77), Expect(3) = 2e-25 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = -1 Query: 2779 SNATLEWLILRTEVFSNLTLFTA 2711 SNA +EWL+LR E NLT+ TA Sbjct: 1596 SNAAMEWLVLRIETLQNLTVITA 1618 Score = 63.5 bits (153), Expect(2) = 1e-19 Identities = 30/47 (63%), Positives = 39/47 (82%) Frame = -2 Query: 2703 LLVLIPKGFVPSELVGLSLSYELTLTKGTRVFLIRWYCSLANYIISV 2563 LL+L+P+G+V S LVGLSLSY +LT G+++F RWYC+L NYIISV Sbjct: 293 LLILVPQGYVTSGLVGLSLSYAFSLT-GSQIFWTRWYCNLLNYIISV 338 Score = 61.6 bits (148), Expect(2) = 1e-19 Identities = 26/34 (76%), Positives = 29/34 (85%) Frame = -3 Query: 2537 SWPSKGTIQFQELKLRYRPNAPLVLKGVTCTFKE 2436 SWPSKG I L++RYRPNAPLVLKG+TCTFKE Sbjct: 363 SWPSKGRIDLHALEIRYRPNAPLVLKGITCTFKE 396 >ref|NP_001189944.1| multidrug resistance-associated protein 6 [Arabidopsis thaliana] gi|334302926|sp|Q8LGU1.3|AB8C_ARATH RecName: Full=ABC transporter C family member 8; Short=ABC transporter ABCC.8; Short=AtABCC8; AltName: Full=ATP-energized glutathione S-conjugate pump 6; AltName: Full=Glutathione S-conjugate-transporting ATPase 6; AltName: Full=Multidrug resistance-associated protein 6; Flags: Precursor gi|332642961|gb|AEE76482.1| multidrug resistance-associated protein 6 [Arabidopsis thaliana] Length = 1464 Score = 65.9 bits (159), Expect(3) = 2e-25 Identities = 33/47 (70%), Positives = 40/47 (85%) Frame = -2 Query: 2703 LLVLIPKGFVPSELVGLSLSYELTLTKGTRVFLIRWYCSLANYIISV 2563 LL+LIPKG++ LVGLSLSY LTLT+ T+VFL RWYC+L+N IISV Sbjct: 1138 LLILIPKGYIAPGLVGLSLSYALTLTQ-TQVFLTRWYCTLSNSIISV 1183 Score = 65.1 bits (157), Expect(3) = 2e-25 Identities = 27/34 (79%), Positives = 31/34 (91%) Frame = -3 Query: 2537 SWPSKGTIQFQELKLRYRPNAPLVLKGVTCTFKE 2436 SWPS GTI QELK+RYRPNAPLVLKG++CTF+E Sbjct: 1208 SWPSNGTIHLQELKIRYRPNAPLVLKGISCTFRE 1241 Score = 34.3 bits (77), Expect(3) = 2e-25 Identities = 14/22 (63%), Positives = 17/22 (77%) Frame = -1 Query: 2779 SNATLEWLILRTEVFSNLTLFT 2714 SNA +EW+ILR E N+TLFT Sbjct: 1113 SNAAMEWVILRIETLQNVTLFT 1134 >ref|NP_188762.3| multidrug resistance-associated protein 6 [Arabidopsis thaliana] gi|332642960|gb|AEE76481.1| multidrug resistance-associated protein 6 [Arabidopsis thaliana] Length = 1453 Score = 65.9 bits (159), Expect(3) = 2e-25 Identities = 33/47 (70%), Positives = 40/47 (85%) Frame = -2 Query: 2703 LLVLIPKGFVPSELVGLSLSYELTLTKGTRVFLIRWYCSLANYIISV 2563 LL+LIPKG++ LVGLSLSY LTLT+ T+VFL RWYC+L+N IISV Sbjct: 1127 LLILIPKGYIAPGLVGLSLSYALTLTQ-TQVFLTRWYCTLSNSIISV 1172 Score = 65.1 bits (157), Expect(3) = 2e-25 Identities = 27/34 (79%), Positives = 31/34 (91%) Frame = -3 Query: 2537 SWPSKGTIQFQELKLRYRPNAPLVLKGVTCTFKE 2436 SWPS GTI QELK+RYRPNAPLVLKG++CTF+E Sbjct: 1197 SWPSNGTIHLQELKIRYRPNAPLVLKGISCTFRE 1230 Score = 34.3 bits (77), Expect(3) = 2e-25 Identities = 14/22 (63%), Positives = 17/22 (77%) Frame = -1 Query: 2779 SNATLEWLILRTEVFSNLTLFT 2714 SNA +EW+ILR E N+TLFT Sbjct: 1102 SNAAMEWVILRIETLQNVTLFT 1123