BLASTX nr result
ID: Atractylodes22_contig00001175
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00001175 (205 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004139092.1| PREDICTED: thioredoxin F2, chloroplastic-lik... 119 3e-25 ref|XP_002514830.1| thioredoxin f-type, putative [Ricinus commun... 119 3e-25 ref|XP_003624192.1| Thioredoxin [Medicago truncatula] gi|3554992... 118 4e-25 ref|NP_001236670.1| uncharacterized protein LOC100306555 [Glycin... 118 4e-25 gb|ACJ83989.1| unknown [Medicago truncatula] gi|388514077|gb|AFK... 118 4e-25 >ref|XP_004139092.1| PREDICTED: thioredoxin F2, chloroplastic-like [Cucumis sativus] gi|449476195|ref|XP_004154668.1| PREDICTED: thioredoxin F2, chloroplastic-like [Cucumis sativus] Length = 180 Score = 119 bits (297), Expect = 3e-25 Identities = 57/67 (85%), Positives = 63/67 (94%) Frame = +3 Query: 3 QWCGPCKVIAPKFQELSEKYLDVVFLKLDCSKDIENKELAKELGIKVVPTFKILKDNKIV 182 QWCGPCKV+APKFQ+LSEKYLDVVFLKLDC +I+NK LAKELGIKVVPTFKILKD K+V Sbjct: 102 QWCGPCKVMAPKFQDLSEKYLDVVFLKLDC--NIDNKPLAKELGIKVVPTFKILKDKKVV 159 Query: 183 REVTGAK 203 +EVTGAK Sbjct: 160 KEVTGAK 166 >ref|XP_002514830.1| thioredoxin f-type, putative [Ricinus communis] gi|223545881|gb|EEF47384.1| thioredoxin f-type, putative [Ricinus communis] Length = 186 Score = 119 bits (297), Expect = 3e-25 Identities = 55/67 (82%), Positives = 64/67 (95%) Frame = +3 Query: 3 QWCGPCKVIAPKFQELSEKYLDVVFLKLDCSKDIENKELAKELGIKVVPTFKILKDNKIV 182 QWCGPCK++APKFQ+LSEKYLDVVFLKLDC++D NK LAKELGI+VVPTFKILKDNK+V Sbjct: 108 QWCGPCKIMAPKFQQLSEKYLDVVFLKLDCNQD--NKPLAKELGIRVVPTFKILKDNKVV 165 Query: 183 REVTGAK 203 +EVTG+K Sbjct: 166 KEVTGSK 172 >ref|XP_003624192.1| Thioredoxin [Medicago truncatula] gi|355499207|gb|AES80410.1| Thioredoxin [Medicago truncatula] Length = 182 Score = 118 bits (296), Expect = 4e-25 Identities = 57/67 (85%), Positives = 64/67 (95%) Frame = +3 Query: 3 QWCGPCKVIAPKFQELSEKYLDVVFLKLDCSKDIENKELAKELGIKVVPTFKILKDNKIV 182 QWCGPCKVIAPK++EL+EKYLDVVFLKLDC++D NK LAKELGIKVVPTFKILKD+KIV Sbjct: 104 QWCGPCKVIAPKYKELAEKYLDVVFLKLDCNQD--NKPLAKELGIKVVPTFKILKDSKIV 161 Query: 183 REVTGAK 203 +EVTGAK Sbjct: 162 KEVTGAK 168 >ref|NP_001236670.1| uncharacterized protein LOC100306555 [Glycine max] gi|255628867|gb|ACU14778.1| unknown [Glycine max] Length = 179 Score = 118 bits (296), Expect = 4e-25 Identities = 57/67 (85%), Positives = 63/67 (94%) Frame = +3 Query: 3 QWCGPCKVIAPKFQELSEKYLDVVFLKLDCSKDIENKELAKELGIKVVPTFKILKDNKIV 182 QWCGPCKV+APKFQELSEKYLDVVFLKLDC++D N+ LA ELGIKVVPTFKILKDNK+V Sbjct: 101 QWCGPCKVMAPKFQELSEKYLDVVFLKLDCNQD--NRPLAIELGIKVVPTFKILKDNKVV 158 Query: 183 REVTGAK 203 +EVTGAK Sbjct: 159 KEVTGAK 165 >gb|ACJ83989.1| unknown [Medicago truncatula] gi|388514077|gb|AFK45100.1| unknown [Medicago truncatula] Length = 186 Score = 118 bits (296), Expect = 4e-25 Identities = 57/67 (85%), Positives = 64/67 (95%) Frame = +3 Query: 3 QWCGPCKVIAPKFQELSEKYLDVVFLKLDCSKDIENKELAKELGIKVVPTFKILKDNKIV 182 QWCGPCKVIAPK++EL+EKYLDVVFLKLDC++D NK LAKELGIKVVPTFKILKD+KIV Sbjct: 108 QWCGPCKVIAPKYKELAEKYLDVVFLKLDCNQD--NKPLAKELGIKVVPTFKILKDSKIV 165 Query: 183 REVTGAK 203 +EVTGAK Sbjct: 166 KEVTGAK 172