BLASTX nr result
ID: Atractylodes22_contig00000854
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00000854 (266 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABW89227.1| chloroplast light-harvesting chlorophyll a/b-bind... 68 7e-10 gb|ABW89213.1| chloroplast light-harvesting chlorophyll a/b-bind... 68 7e-10 dbj|BAA03104.1| light-harvesting chlorophyll a/b-binding protein... 68 7e-10 gb|ABW89216.1| chloroplast light-harvesting chlorophyll a/b-bind... 66 3e-09 gb|AAA80594.1| chlorophyll a/b binding protein [Solanum tuberosum] 66 3e-09 >gb|ABW89227.1| chloroplast light-harvesting chlorophyll a/b-binding protein [Helianthus annuus] Length = 116 Score = 68.2 bits (165), Expect = 7e-10 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -1 Query: 266 KGPLENLADHLADPVANNAWSYATNFVPGK 177 KGPLENLADHLADPVANNAWSYATNFVPGK Sbjct: 87 KGPLENLADHLADPVANNAWSYATNFVPGK 116 >gb|ABW89213.1| chloroplast light-harvesting chlorophyll a/b-binding protein [Helianthus annuus] gi|159138423|gb|ABW89214.1| chloroplast light-harvesting chlorophyll a/b-binding protein [Helianthus annuus] gi|159138425|gb|ABW89215.1| chloroplast light-harvesting chlorophyll a/b-binding protein [Helianthus annuus] gi|159138429|gb|ABW89217.1| chloroplast light-harvesting chlorophyll a/b-binding protein [Helianthus annuus] gi|159138433|gb|ABW89219.1| chloroplast light-harvesting chlorophyll a/b-binding protein [Helianthus annuus] gi|159138437|gb|ABW89221.1| chloroplast light-harvesting chlorophyll a/b-binding protein [Helianthus annuus] gi|159138439|gb|ABW89222.1| chloroplast light-harvesting chlorophyll a/b-binding protein [Helianthus annuus] gi|159138441|gb|ABW89223.1| chloroplast light-harvesting chlorophyll a/b-binding protein [Helianthus annuus] gi|159138443|gb|ABW89224.1| chloroplast light-harvesting chlorophyll a/b-binding protein [Helianthus annuus] gi|159138445|gb|ABW89225.1| chloroplast light-harvesting chlorophyll a/b-binding protein [Helianthus annuus] gi|159138447|gb|ABW89226.1| chloroplast light-harvesting chlorophyll a/b-binding protein [Helianthus annuus] gi|159138451|gb|ABW89228.1| chloroplast light-harvesting chlorophyll a/b-binding protein [Helianthus annuus] gi|159138453|gb|ABW89229.1| chloroplast light-harvesting chlorophyll a/b-binding protein [Helianthus annuus] gi|159138455|gb|ABW89230.1| chloroplast light-harvesting chlorophyll a/b-binding protein [Helianthus annuus] gi|159138457|gb|ABW89231.1| chloroplast light-harvesting chlorophyll a/b-binding protein [Helianthus annuus] Length = 116 Score = 68.2 bits (165), Expect = 7e-10 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -1 Query: 266 KGPLENLADHLADPVANNAWSYATNFVPGK 177 KGPLENLADHLADPVANNAWSYATNFVPGK Sbjct: 87 KGPLENLADHLADPVANNAWSYATNFVPGK 116 >dbj|BAA03104.1| light-harvesting chlorophyll a/b-binding protein (LHCP) precursor [Lactuca sativa] Length = 266 Score = 68.2 bits (165), Expect = 7e-10 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -1 Query: 266 KGPLENLADHLADPVANNAWSYATNFVPGK 177 KGPLENLADHLADPVANNAWSYATNFVPGK Sbjct: 237 KGPLENLADHLADPVANNAWSYATNFVPGK 266 >gb|ABW89216.1| chloroplast light-harvesting chlorophyll a/b-binding protein [Helianthus annuus] gi|159138431|gb|ABW89218.1| chloroplast light-harvesting chlorophyll a/b-binding protein [Helianthus annuus] gi|159138435|gb|ABW89220.1| chloroplast light-harvesting chlorophyll a/b-binding protein [Helianthus annuus] Length = 116 Score = 66.2 bits (160), Expect = 3e-09 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = -1 Query: 266 KGPLENLADHLADPVANNAWSYATNFVPG 180 KGPLENLADHLADPVANNAWSYATNFVPG Sbjct: 87 KGPLENLADHLADPVANNAWSYATNFVPG 115 >gb|AAA80594.1| chlorophyll a/b binding protein [Solanum tuberosum] Length = 265 Score = 65.9 bits (159), Expect = 3e-09 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = -1 Query: 266 KGPLENLADHLADPVANNAWSYATNFVPGK 177 KGPLENLADHLADPV NNAWSYATNFVPGK Sbjct: 236 KGPLENLADHLADPVNNNAWSYATNFVPGK 265