BLASTX nr result
ID: Atractylodes22_contig00000744
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00000744 (587 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABA08415.1| type 2 metallothionein [Arachis hypogaea] gi|7447... 57 2e-06 gb|AAZ20290.1| type 2 metallothionein [Arachis hypogaea] gi|7447... 57 2e-06 ref|XP_003568919.1| PREDICTED: metallothionein-like protein type... 57 2e-06 ref|XP_002455197.1| hypothetical protein SORBIDRAFT_03g006090 [S... 57 2e-06 gb|ACG30993.1| metallothionein-like protein type 2 [Zea mays] gi... 57 3e-06 >gb|ABA08415.1| type 2 metallothionein [Arachis hypogaea] gi|74476676|gb|ABA08416.1| type 2 metallothionein [Arachis hypogaea] gi|77955918|gb|ABB05520.1| type 2 metallothionein [Arachis hypogaea] Length = 80 Score = 57.4 bits (137), Expect = 2e-06 Identities = 33/59 (55%), Positives = 35/59 (59%), Gaps = 3/59 (5%) Frame = -3 Query: 387 KMYPDMXXXXXXXXXXTLVPGVAPNKRASGCEGEERG--AENGGCKCNP-CKCDPCTCK 220 KMYPD+ TLV GVAP K + EG E G AENGGCKC C CDPCTCK Sbjct: 24 KMYPDLSYTESMSSTETLVMGVAPMK--AQFEGAEMGVSAENGGCKCGSNCTCDPCTCK 80 >gb|AAZ20290.1| type 2 metallothionein [Arachis hypogaea] gi|74476672|gb|ABA08414.1| type 2 metallothionein [Arachis hypogaea] Length = 80 Score = 57.4 bits (137), Expect = 2e-06 Identities = 33/59 (55%), Positives = 35/59 (59%), Gaps = 3/59 (5%) Frame = -3 Query: 387 KMYPDMXXXXXXXXXXTLVPGVAPNKRASGCEGEERG--AENGGCKCNP-CKCDPCTCK 220 KMYPD+ TLV GVAP K + EG E G AENGGCKC C CDPCTCK Sbjct: 24 KMYPDLSYTESISSTETLVMGVAPMK--AQFEGAEMGVSAENGGCKCGSNCTCDPCTCK 80 >ref|XP_003568919.1| PREDICTED: metallothionein-like protein type 2-like isoform 1 [Brachypodium distachyon] gi|357134631|ref|XP_003568920.1| PREDICTED: metallothionein-like protein type 2-like isoform 2 [Brachypodium distachyon] Length = 79 Score = 57.4 bits (137), Expect = 2e-06 Identities = 30/57 (52%), Positives = 33/57 (57%), Gaps = 1/57 (1%) Frame = -3 Query: 387 KMYPDMXXXXXXXXXXTLVPGVAPNKRASGCEGEERGAENGGCKC-NPCKCDPCTCK 220 KMYP+M LV GVAP SG E GAENGGCKC + C C+PCTCK Sbjct: 24 KMYPEMMAEEATSSQT-LVMGVAPPATKSGFEAAAAGAENGGCKCGDNCTCNPCTCK 79 >ref|XP_002455197.1| hypothetical protein SORBIDRAFT_03g006090 [Sorghum bicolor] gi|241927172|gb|EES00317.1| hypothetical protein SORBIDRAFT_03g006090 [Sorghum bicolor] Length = 84 Score = 57.4 bits (137), Expect = 2e-06 Identities = 31/61 (50%), Positives = 34/61 (55%), Gaps = 5/61 (8%) Frame = -3 Query: 387 KMYPDMXXXXXXXXXXTLVPGVAPNKRASGCEGEE----RGAENGGCKCNP-CKCDPCTC 223 KMYPDM TLV GVAP+ + G E GAEN GCKC P C C+PCTC Sbjct: 24 KMYPDMAEQQVTTTAKTLVMGVAPSSKGHAEGGFEAAAGAGAENDGCKCGPNCSCNPCTC 83 Query: 222 K 220 K Sbjct: 84 K 84 >gb|ACG30993.1| metallothionein-like protein type 2 [Zea mays] gi|195626324|gb|ACG34992.1| metallothionein-like protein type 2 [Zea mays] gi|195636536|gb|ACG37736.1| metallothionein-like protein type 2 [Zea mays] gi|195645318|gb|ACG42127.1| metallothionein-like protein type 2 [Zea mays] Length = 83 Score = 56.6 bits (135), Expect = 3e-06 Identities = 29/57 (50%), Positives = 32/57 (56%), Gaps = 2/57 (3%) Frame = -3 Query: 387 KMYPDMXXXXXXXXXXTLVPGVAPNK-RASGCEGEERGAENGGCKC-NPCKCDPCTC 223 KMYPDM L+ GVAP+K A G GAENGGCKC C+CDPC C Sbjct: 25 KMYPDMAEQVTTTTTQALIMGVAPSKGHAEGGFEAAAGAENGGCKCGGNCQCDPCNC 81